BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0586 (754 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G10.09 |||glucosidase I Gls1 |Schizosaccharomyces pombe|chr... 28 1.6 SPBC83.09c |||GYF domain|Schizosaccharomyces pombe|chr 2|||Manual 26 5.0 >SPAC6G10.09 |||glucosidase I Gls1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 808 Score = 27.9 bits (59), Expect = 1.6 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +2 Query: 209 ELITNVVNNLIRNNKRTA--WSTPTSSGCKAPRTSSGDCFPVEFTLILAENY 358 EL TNVVNN+ N ++T W + K RT + I++ENY Sbjct: 757 ELRTNVVNNVFENWRQTGIFWEQYDPTTGKGQRTKDFTGWTSLVVNIMSENY 808 >SPBC83.09c |||GYF domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 408 Score = 26.2 bits (55), Expect = 5.0 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 155 DYDSAVERSKLIYTDNKGELITNVVNNLIRNNKRTAWSTPTS 280 D D + SKL Y D +G+ TN N+L + + + S P+S Sbjct: 115 DEDDNGKYSKLRYEDIEGQEDTNQANDLDADEEGSEISVPSS 156 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,867,733 Number of Sequences: 5004 Number of extensions: 55556 Number of successful extensions: 120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 359287726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -