BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0586 (754 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. 23 2.3 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 3.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.4 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 7.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 7.1 >U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. Length = 53 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 550 FGLSMPSSVCAQCSYLEVDLVVLPQRNEFPADS*TGP 440 F ++ +++CA +Y+ + V P R FP GP Sbjct: 6 FIFALLATICAAFAYVPLPNVPQPGRRPFPTFPGQGP 42 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 262 CSSLVVXYQIVYDICDEL 209 CS + Y+I D+CD L Sbjct: 116 CSGITSAYKIEIDMCDRL 133 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 272 PTSSGCKAPRTSSGDCFPVEFTLILAE 352 PT C R ++G CF V + +L + Sbjct: 716 PTDIVCGIQRFAAGFCFTVVYAALLTK 742 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 176 RSKLIYTDNKGELITNVVNNLIRNNKRTAWS 268 ++ ++ ++N L N ++N NN+RT WS Sbjct: 367 KNDVLLSNNDVYLYQNTMSN---NNQRTEWS 394 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 176 RSKLIYTDNKGELITNVVNNLIRNNKRTAWS 268 ++ ++ ++N L N ++N NN+RT WS Sbjct: 405 KNDVLLSNNDVYLYQNTMSN---NNQRTEWS 432 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,902 Number of Sequences: 438 Number of extensions: 3989 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -