BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0586 (754 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03220.1 68415.m00275 galactoside 2-alpha-L-fucosyltransferas... 31 0.62 At4g20850.1 68417.m03025 subtilase family protein contains simil... 28 5.8 At3g63330.1 68416.m07125 protein kinase family protein contains ... 28 5.8 At3g16950.1 68416.m02166 dihydrolipoamide dehydrogenase 1, plast... 28 5.8 At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF... 28 7.7 >At2g03220.1 68415.m00275 galactoside 2-alpha-L-fucosyltransferase / xyloglucan alpha-(1,2)-fucosyltransferase (FUT1) (FT1) identical to SP|Q9SWH5 Galactoside 2-alpha-L-fucosyltransferase (EC 2.4.1.69) (Xyloglucan alpha-(1,2)-fucosyltransferase) (AtFUT1) {Arabidopsis thaliana} Length = 558 Score = 31.5 bits (68), Expect = 0.62 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 146 IIADYDSAVERSKLIYTD-NKGELITNVVNNLIRNNKRTAWSTPTSSG 286 ++ + D+ VERS+ + T +K L+T++ N K W PTS+G Sbjct: 391 LLPEVDTLVERSRHVNTPKHKAVLVTSLNAGYAENLKSMYWEYPTSTG 438 >At4g20850.1 68417.m03025 subtilase family protein contains similarity to Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) (Swiss-Prot:P29144) [Homo sapiens] Length = 1380 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 128 LRQDFVEGCAFVGVQRRREKTQDNNSGLHLRSAGFFGSSC 9 L +DF+ F+ +R R ++ + G+ LR +GF C Sbjct: 32 LPRDFISSSTFLLHRRLRRRSCSRSRGIRLRRSGFSAMPC 71 >At3g63330.1 68416.m07125 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 376 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 5/56 (8%) Frame = +2 Query: 134 YNDVIIADYDSAVERSKLIYTDNKGELITNVV-----NNLIRNNKRTAWSTPTSSG 286 YND+ + + V SKL+YT + E+ + ++R +K W T SG Sbjct: 68 YNDIWLVFHHEGVSLSKLMYTVEEAEISSEKAEEASHGQILRPSKWWTWLKTTESG 123 >At3g16950.1 68416.m02166 dihydrolipoamide dehydrogenase 1, plastidic / lipoamide dehydrogenase 1 (PTLPD1) identical to plastidic lipoamide dehydrogenase from Arabidopsis thaliana [gi:7159282] Length = 570 Score = 28.3 bits (60), Expect = 5.8 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +1 Query: 415 GCLRGQQRQDQFKS-QLEIHSAVGEQQGLLQDKNTERKQNLALKVRTNRNGDHMAYGVAN 591 G +R Q + KS L++ +A ++QG+ N NLA K+R N A GV Sbjct: 140 GRMRELQNEHHMKSFGLQVSAAGYDRQGVADHAN-----NLATKIRNNLTNSMKAIGVDI 194 Query: 592 FDGF 603 GF Sbjct: 195 LTGF 198 >At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF) identical to alpha-glucosidase I (GI:16506680, GI:13398928) [Arabidopsis thaliana] Length = 852 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 173 ERSKLIYTDNKGELITNVVNN 235 E+SK IYT+ + LI NVV N Sbjct: 790 EKSKAIYTELRSNLIRNVVRN 810 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,469,788 Number of Sequences: 28952 Number of extensions: 307569 Number of successful extensions: 851 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -