BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0585 (531 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0061 + 12489552-12489674,12490761-12490836,12490916-124909... 29 3.1 08_02_0519 - 18097509-18097726,18097803-18097967,18098095-180983... 29 3.1 03_05_0859 - 28329837-28329919,28330062-28330131,28330498-283305... 27 9.4 >10_07_0061 + 12489552-12489674,12490761-12490836,12490916-12490980, 12491089-12491166,12492156-12492236,12492813-12492974, 12493328-12493426,12493509-12494797,12495063-12495286, 12495373-12495500,12495596-12495634,12495724-12497178 Length = 1272 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 195 KQLQTIQISDTEYGATSCQRRTEPAEQQPAT 103 +QLQ + + +Y A+ QR T P Q+PA+ Sbjct: 406 QQLQQLDVKGMQYAASVGQRYTHPHVQEPAS 436 >08_02_0519 - 18097509-18097726,18097803-18097967,18098095-18098305, 18099151-18099419,18100915-18101017 Length = 321 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 183 TIQISDTEYGATSCQRRTEPAEQQPATSAF 94 T+ + E+ +T C RR + AEQ A A+ Sbjct: 73 TVMVDGEEFSSTFCHRRVKDAEQDAAKVAY 102 >03_05_0859 - 28329837-28329919,28330062-28330131,28330498-28330549, 28330671-28330798,28331283-28331483,28332183-28332317, 28333116-28333275,28333824-28334019,28334070-28334252, 28334382-28334507,28335090-28335214,28335389-28335541, 28337267-28337472 Length = 605 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 86 LVRKADVAGCCSAGSVLR*HEVAPYSVSLI 175 L A ++GCC L H+ P SVSLI Sbjct: 417 LTSLASMSGCCQVTVPLGTHDKCPVSVSLI 446 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,111,032 Number of Sequences: 37544 Number of extensions: 200088 Number of successful extensions: 321 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 321 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1178343540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -