BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0585 (531 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025464-2|AAN84804.1| 496|Caenorhabditis elegans Prion-like-(q... 29 2.1 AF025464-1|AAN84805.1| 529|Caenorhabditis elegans Prion-like-(q... 29 2.1 L07144-6|AAK21443.1| 834|Caenorhabditis elegans Temporarily ass... 27 8.4 L07144-5|AAU20841.1| 837|Caenorhabditis elegans Temporarily ass... 27 8.4 >AF025464-2|AAN84804.1| 496|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 42, isoform a protein. Length = 496 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 97 FPNQMIEQINIALEQKGSGNFSAWVIEACRRI 2 FPN I++ + G+ NF A+V++ C R+ Sbjct: 92 FPNLQIDRAGEGWPRLGAQNFDAFVLDGCSRV 123 >AF025464-1|AAN84805.1| 529|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 42, isoform b protein. Length = 529 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 97 FPNQMIEQINIALEQKGSGNFSAWVIEACRRI 2 FPN I++ + G+ NF A+V++ C R+ Sbjct: 114 FPNLQIDRAGEGWPRLGAQNFDAFVLDGCSRV 145 >L07144-6|AAK21443.1| 834|Caenorhabditis elegans Temporarily assigned gene nameprotein 84, isoform a protein. Length = 834 Score = 27.1 bits (57), Expect = 8.4 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = -1 Query: 426 DRLFANESXPXLS--ETLRRASFPF-DAMFCVTCRITGKDP*SDNDYHLHITTCVEAI 262 +R+ NES P S + L A+ + + C +C+ KD YHL TC++ + Sbjct: 752 ERVKRNESVPAQSGDQVLEEANRQMKETLTCPSCKTRPKDCIMLKCYHLFCETCIKTM 809 >L07144-5|AAU20841.1| 837|Caenorhabditis elegans Temporarily assigned gene nameprotein 84, isoform b protein. Length = 837 Score = 27.1 bits (57), Expect = 8.4 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = -1 Query: 426 DRLFANESXPXLS--ETLRRASFPF-DAMFCVTCRITGKDP*SDNDYHLHITTCVEAI 262 +R+ NES P S + L A+ + + C +C+ KD YHL TC++ + Sbjct: 755 ERVKRNESVPAQSGDQVLEEANRQMKETLTCPSCKTRPKDCIMLKCYHLFCETCIKTM 812 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,297,138 Number of Sequences: 27780 Number of extensions: 173341 Number of successful extensions: 270 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 270 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1049512662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -