BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0583 (858 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutath... 24 5.1 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 24 5.1 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 6.8 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 24 6.8 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 23 9.0 >AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutathione transferase GSTMIC3protein. Length = 147 Score = 24.2 bits (50), Expect = 5.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 88 IILVYIRHTGFNLLV*ISQFRTMNLTI 8 + +V I HT F++LV + +FR M+ I Sbjct: 104 VAVVRISHTVFHVLVPVHKFRGMSWAI 130 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 24.2 bits (50), Expect = 5.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -3 Query: 439 CIDVKFPILRCKIGLAPYFSWFTF 368 CI ++F +++ +IGLA F+F Sbjct: 443 CIGLRFGMMQARIGLAYLLQGFSF 466 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.8 bits (49), Expect = 6.8 Identities = 11/49 (22%), Positives = 21/49 (42%) Frame = -1 Query: 408 AKSAWLHTFLGSPLFSSVVSPCADSFSINHFSDKLYTCFCLSGSLFTSF 262 A + W G P ++++ + I+H + CF G L+ S+ Sbjct: 326 ALAKWASGQTGFPWIDAIMTQLREEGWIHHLARHAVACFLTRGDLWISW 374 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 23.8 bits (49), Expect = 6.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -3 Query: 439 CIDVKFPILRCKIGLAPYFSWFTF 368 CI ++F +++ +IGLA + F F Sbjct: 384 CIGLRFGMMQARIGLAYLLTGFRF 407 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.4 bits (48), Expect = 9.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 439 CIDVKFPILRCKIGLAPYFSWFTF 368 CI +F +L ++GLA F+F Sbjct: 444 CIAARFGMLEARVGLAVLLMHFSF 467 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,983 Number of Sequences: 2352 Number of extensions: 16723 Number of successful extensions: 37 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91372671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -