BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0582 (791 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 29 1.0 SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos... 27 2.3 SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk... 26 7.1 SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ... 25 9.4 SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual 25 9.4 SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces po... 25 9.4 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 28.7 bits (61), Expect = 1.0 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +3 Query: 102 CLINFRW*F---LRLPWLSRVTGNQGSIPEREPEKRLP 206 C+IN W LRL +L + NQ S E++ EKR+P Sbjct: 271 CMINETWPVDRALRLQFLIQQRNNQSSNEEQKQEKRVP 308 >SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 27.5 bits (58), Expect = 2.3 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 227 RANYPLPAREVVTKNNDT 280 +AN P+P EVVT+NN T Sbjct: 199 KANIPVPTSEVVTENNVT 216 >SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.8 bits (54), Expect = 7.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 215 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 117 P MW P N+ + YP +PW S+ LPS Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267 >SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 9.4 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 213 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 112 L ++ S+ P + PD P T+ V+ TT+E+ Sbjct: 422 LGLINTSEINQPANLPDEPTAETSNPVSATTVEA 455 >SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual Length = 478 Score = 25.4 bits (53), Expect = 9.4 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -2 Query: 262 HYLPCREWVICAPA 221 HY+PC+ W++ P+ Sbjct: 455 HYIPCQSWLVWYPS 468 >SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces pombe|chr 1|||Manual Length = 949 Score = 25.4 bits (53), Expect = 9.4 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 6/71 (8%) Frame = +1 Query: 472 DTFP---IGLLHSVHIKTSDEDCXEPGTNGS--VPAVAR-LLGWGXNIQVSSTEGRXKNF 633 DT+P + L S+HI +E G S +P + R LL W N Q ST+ +F Sbjct: 582 DTYPPNNVIYLFSLHIIFHNELESLCGITQSSFIPTIMRQLLDWFKNFQRYSTQKLASSF 641 Query: 634 XFKIWRRYRTE 666 ++W E Sbjct: 642 ERELWEAIPVE 652 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,933,377 Number of Sequences: 5004 Number of extensions: 56229 Number of successful extensions: 112 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -