BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0582 (791 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 26 1.5 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 26 1.5 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 26 1.5 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 26 1.5 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 8.2 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 621 PTLRATDLDVXPPAQQTRHGGHGPIGPR 538 P + L P QQ +H HGP GP+ Sbjct: 10 PQRQHPSLVAGPQQQQQQHQQHGPSGPQ 37 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 621 PTLRATDLDVXPPAQQTRHGGHGPIGPR 538 P + L P QQ +H HGP GP+ Sbjct: 10 PQRQHPSLVAGPQQQQQQHQQHGPSGPQ 37 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 621 PTLRATDLDVXPPAQQTRHGGHGPIGPR 538 P + L P QQ +H HGP GP+ Sbjct: 10 PQRQHPSLVAGPQQQQQQHQQHGPSGPQ 37 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 621 PTLRATDLDVXPPAQQTRHGGHGPIGPR 538 P + L P QQ +H HGP GP+ Sbjct: 81 PQRQHPSLVAGPQQQQQQHQQHGPSGPQ 108 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 23.4 bits (48), Expect = 8.2 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -1 Query: 275 RYFSSLPPVPGVGNLRACCLPWMW*PFLRLPLRNRTLIPRYP 150 RY L + + NLR + LR NRT PRYP Sbjct: 263 RYAQGLGRIEPLANLREPVREAYYPKLLRTS-NNRTFCPRYP 303 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 774,044 Number of Sequences: 2352 Number of extensions: 15441 Number of successful extensions: 66 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -