Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0580
         (300 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous ho...    27   8.2  

>AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous
           homologue 2_splice_variant1 protein.
          Length = 1147

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = -3

Query: 238 SGLXVLGRESVCGDVEVSXLSCSDRGXFQFDFKVIPPPKMNSVELFQVAPGQVV 77
           S + ++G ES+  +V  +  S  +       F ++  P+ NSV+L QVA  Q++
Sbjct: 247 SAVCIVGEESILEEVLEALTSAGEEKKIDRFFCIVEGPRHNSVQL-QVACMQLI 299


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,638,123
Number of Sequences: 237096
Number of extensions: 403938
Number of successful extensions: 803
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 803
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 803
length of database: 76,859,062
effective HSP length: 76
effective length of database: 58,839,766
effective search space used: 1353314618
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)