BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0580 (300 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous ho... 27 8.2 >AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous homologue 2_splice_variant1 protein. Length = 1147 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = -3 Query: 238 SGLXVLGRESVCGDVEVSXLSCSDRGXFQFDFKVIPPPKMNSVELFQVAPGQVV 77 S + ++G ES+ +V + S + F ++ P+ NSV+L QVA Q++ Sbjct: 247 SAVCIVGEESILEEVLEALTSAGEEKKIDRFFCIVEGPRHNSVQL-QVACMQLI 299 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,638,123 Number of Sequences: 237096 Number of extensions: 403938 Number of successful extensions: 803 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 76,859,062 effective HSP length: 76 effective length of database: 58,839,766 effective search space used: 1353314618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -