BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0579 (801 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18310.2 68418.m02155 expressed protein predicted proteins, D... 28 8.3 At5g18310.1 68418.m02154 expressed protein predicted proteins, D... 28 8.3 >At5g18310.2 68418.m02155 expressed protein predicted proteins, Drosophila melanogaster Length = 167 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 105 KGKRYTVQKIEASESKYFINFRTITFFKNDV 197 +G + V+ + A KY+I+ + FKNDV Sbjct: 96 RGPQRRVRDVSAQSDKYYIDVNGVKQFKNDV 126 >At5g18310.1 68418.m02154 expressed protein predicted proteins, Drosophila melanogaster Length = 139 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 105 KGKRYTVQKIEASESKYFINFRTITFFKNDV 197 +G + V+ + A KY+I+ + FKNDV Sbjct: 68 RGPQRRVRDVSAQSDKYYIDVNGVKQFKNDV 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,963,243 Number of Sequences: 28952 Number of extensions: 213737 Number of successful extensions: 282 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 282 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -