BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0578 (576 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0121 + 16864735-16865619,16865706-16866026 29 2.7 01_06_0276 - 28084746-28085003,28085103-28085357,28085531-280857... 29 2.7 12_01_0631 - 5234452-5234468,5234536-5234839,5234926-5235810 29 3.5 08_01_0831 + 8086470-8087354,8087441-8087730,8096373-8096412,809... 29 3.5 06_03_0573 + 22407489-22408373,22408460-22408795 29 3.5 03_03_0153 - 14910420-14910769,14910946-14911008,14911084-149113... 29 3.5 07_01_1077 - 9687394-9687515,9696615-9696733,9696815-9697104,969... 28 4.6 04_01_0291 + 3848091-3848975,3849062-3849351,3858003-3858339 28 4.6 03_04_0145 + 17683681-17683982,17686058-17686145 28 4.6 06_03_0176 - 17575155-17575761,17575935-17575972 28 6.1 12_01_0977 - 9900073-9900521,9900594-9900698,9900770-9900959,990... 27 8.1 10_08_0231 - 16045293-16045309,16045377-16045677,16045764-16046648 27 8.1 02_04_0090 - 19643182-19643322,19644192-19644335,19644563-196446... 27 8.1 >06_03_0121 + 16864735-16865619,16865706-16866026 Length = 401 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 151 QIRSPADHAVRSGSGKTLRAGPAHRWDAP 237 Q RSP H V+ G G T+R+ P + P Sbjct: 308 QRRSPRQHTVQGGGGPTIRSDPQPQTSKP 336 >01_06_0276 - 28084746-28085003,28085103-28085357,28085531-28085798, 28085948-28086253,28086369-28086643,28087034-28087252, 28087486-28089015,28089236-28089397,28089512-28089666, 28090195-28091064,28091363-28091832,28091917-28091981, 28092105-28092448,28092531-28092710,28092817-28092920, 28093053-28093162,28093648-28093744,28094138-28094238, 28094324-28094476,28094561-28094674,28094795-28094884, 28094960-28095307 Length = 2157 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 255 HRLYMPRGVPPVGRPSTKCLPGPGANCVIRWRTN 154 H L P PP G K LP PG WR N Sbjct: 884 HELAFPSRAPPPGSADAKALPNPGD---YHWRKN 914 >12_01_0631 - 5234452-5234468,5234536-5234839,5234926-5235810 Length = 401 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 151 QIRSPADHAVRSGSGKTLRAGPAHRWDAP 237 Q RSP H V+ G G T+R+ P + P Sbjct: 308 QRRSPRQHTVQGGGGPTIRSDPQPQTSNP 336 >08_01_0831 + 8086470-8087354,8087441-8087730,8096373-8096412, 8096878-8096957,8099643-8099733,8099989-8100052, 8100553-8100818 Length = 571 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 151 QIRSPADHAVRSGSGKTLRAGPAHRWDAP 237 Q RSP H V+ G G T+R+ P + P Sbjct: 308 QRRSPRQHTVQGGGGPTIRSDPQPQTSNP 336 >06_03_0573 + 22407489-22408373,22408460-22408795 Length = 406 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 151 QIRSPADHAVRSGSGKTLRAGPAHRWDAP 237 Q RSP H V+ G G T+R+ P + P Sbjct: 308 QRRSPRQHTVQGGGGPTIRSDPQPQTSNP 336 >03_03_0153 - 14910420-14910769,14910946-14911008,14911084-14911339, 14911432-14911522,14911798-14912096,14912177-14912295, 14922536-14922594,14922676-14922965,14923052-14923567, 14923634-14923936 Length = 781 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 151 QIRSPADHAVRSGSGKTLRAGPAHRWDAP 237 Q RSP H V+ G G T+R+ P + P Sbjct: 286 QRRSPRQHTVQGGGGPTIRSDPQPQTSNP 314 >07_01_1077 - 9687394-9687515,9696615-9696733,9696815-9697104, 9697191-9698075 Length = 471 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 151 QIRSPADHAVRSGSGKTLRAGP 216 Q RSP H V+ G G T+R+ P Sbjct: 308 QRRSPRQHTVQGGGGPTIRSDP 329 >04_01_0291 + 3848091-3848975,3849062-3849351,3858003-3858339 Length = 503 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 151 QIRSPADHAVRSGSGKTLRAGP 216 Q RSP H V+ G G T+R+ P Sbjct: 308 QRRSPRQHTVQGGGGPTIRSDP 329 >03_04_0145 + 17683681-17683982,17686058-17686145 Length = 129 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -3 Query: 223 GGQAQHEVSSRTRSELRDPLENESGGPVGNDAG 125 GG+ V SR RSE+RD + +++ GP DAG Sbjct: 42 GGEQSGGVWSR-RSEMRDVVGSDAMGPAERDAG 73 >06_03_0176 - 17575155-17575761,17575935-17575972 Length = 214 Score = 27.9 bits (59), Expect = 6.1 Identities = 21/75 (28%), Positives = 31/75 (41%) Frame = +1 Query: 124 CQHRCRLGRQIRSPADHAVRSGSGKTLRAGPAHRWDAPRHVQTVIEFHKEGKLSFKYVTT 303 C+ C + R R R G+ R GPA RW + R T ++ SF+ + Sbjct: 64 CRVECNVARHRRL---RLRRGRGGRGARRGPATRWWSSRRATT---SRRQDYTSFEGPSM 117 Query: 304 FNMDEYVGLPRDHPE 348 + E+ G R H E Sbjct: 118 NQLYEFGGSVRHHDE 132 >12_01_0977 - 9900073-9900521,9900594-9900698,9900770-9900959, 9901035-9901093,9901297-9901688,9901770-9902059, 9902146-9903030 Length = 789 Score = 27.5 bits (58), Expect = 8.1 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = +1 Query: 55 VIRYCHR*RVKVIPNYASYNSRRCQHRCRLG----RQIRSPADHAVRSGSGKTLRAGPAH 222 V+ Y H+ + V+P Y ++N +H Q RSP H ++ G T+R+ P Sbjct: 275 VVSYSHQ--LPVVP-YNAFNPPPQEHVLMKSDPPIAQRRSPRQHTIQGSGGPTIRSDPQP 331 Query: 223 RWDAP 237 + P Sbjct: 332 QTSKP 336 >10_08_0231 - 16045293-16045309,16045377-16045677,16045764-16046648 Length = 400 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 151 QIRSPADHAVRSGSGKTLRAGP 216 Q RSP H V+ G G T+R P Sbjct: 308 QHRSPRQHTVQGGGGPTIRLDP 329 >02_04_0090 - 19643182-19643322,19644192-19644335,19644563-19644626, 19644710-19644796,19645371-19645513,19645706-19645771, 19645954-19646046,19646165-19646230,19646363-19646433, 19646882-19646982,19647217-19647317,19647421-19647528, 19647639-19648064 Length = 536 Score = 27.5 bits (58), Expect = 8.1 Identities = 20/66 (30%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Frame = +3 Query: 189 VREDTSCWACPPVGRPSACTNGDRVPQG-REVIFQICDHFQHGRVCGXXXXXXXXXXXXH 365 VR P + RP DR+P G R+ + DHF GRV Sbjct: 67 VRARAGTIQAPGLARPGGAVETDRLPSGVRDRAMEAVDHF-GGRVTIGDVASRAGLQLAQ 125 Query: 366 VERVLQ 383 ER LQ Sbjct: 126 AERALQ 131 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,795,101 Number of Sequences: 37544 Number of extensions: 377486 Number of successful extensions: 1125 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1340735508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -