BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0578 (576 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 25 0.41 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 24 0.94 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 24 0.94 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 24 0.94 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 22 3.8 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 22 3.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 5.0 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 6.6 AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 21 8.7 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 21 8.7 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 25.4 bits (53), Expect = 0.41 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 346 ESYHYYMWNEFFKHIDIEPSNAHVLXGNASDLVL-XCQR 459 ES Y W HID +P + A +VL CQR Sbjct: 183 ESNENYNWEHKETHIDWQPEDEECTEATAGAVVLETCQR 221 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 24.2 bits (50), Expect = 0.94 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 305 KVVTYLKDNFPSLWNSI 255 KV+ +L +N P LW+S+ Sbjct: 89 KVIKFLVENKPELWDSL 105 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 24.2 bits (50), Expect = 0.94 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 305 KVVTYLKDNFPSLWNSI 255 KV+ +L +N P LW+S+ Sbjct: 89 KVIKFLVENKPELWDSL 105 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 24.2 bits (50), Expect = 0.94 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 305 KVVTYLKDNFPSLWNSI 255 KV+ +L +N P LW+S+ Sbjct: 89 KVIKFLVENKPELWDSL 105 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 305 KVVTYLKDNFPSLW 264 KVV +L DN P +W Sbjct: 88 KVVQFLIDNKPEIW 101 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -3 Query: 247 VHAEGRPTGGQAQHEVSSRTRSE 179 + A+ PTG QH + +R + E Sbjct: 104 LEAKYDPTGAYKQHYLQNRVKEE 126 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 305 KVVTYLKDNFPSLW 264 KVV +L DN P +W Sbjct: 88 KVVQFLIDNKPEIW 101 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -3 Query: 247 VHAEGRPTGGQAQHEVSSRTRSE 179 + A+ PTG QH + +R + E Sbjct: 104 LEAKYDPTGAYKQHYLQNRVKEE 126 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.8 bits (44), Expect = 5.0 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = -3 Query: 247 VHAEGRPTGGQAQHEVSSRTRSELRDPLENESGGPVGNDAG 125 V+ G Q V SR L PL+ E G P G G Sbjct: 366 VYRPGENPVTQRLPAVLSRIGIILASPLKREGGPPTGATTG 406 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -1 Query: 225 PVGRPSTKCLPGPGANCVIRWRTNLAAQSAT 133 P+G+ +KC C + +TNL+ S++ Sbjct: 703 PIGKALSKCHNRNVTTCNMFRKTNLSGDSSS 733 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 69 SPLTCESNPELCVL 110 SP CE NP+L +L Sbjct: 83 SPPFCEKNPKLGIL 96 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 69 SPLTCESNPELCVL 110 SP CE NP+L +L Sbjct: 84 SPPFCEKNPKLGIL 97 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,802 Number of Sequences: 438 Number of extensions: 3385 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -