BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0577 (790 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) 114 9e-26 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 101 9e-22 SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) 99 5e-21 SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 80 2e-15 SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) 32 0.46 SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26) 31 1.1 SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) 30 2.5 SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) 30 2.5 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) 28 7.5 SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_21189| Best HMM Match : PCI (HMM E-Value=8.2) 28 7.5 SB_43213| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_37907| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) Length = 123 Score = 114 bits (274), Expect = 9e-26 Identities = 54/95 (56%), Positives = 69/95 (72%), Gaps = 2/95 (2%) Frame = +1 Query: 259 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 438 +D+ L +F+T +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG GQ Sbjct: 1 MDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQ 60 Query: 439 TREHALLAFTLGVKQLIVGVNK--MVPLNHHTVSP 537 TREHA+L +LGV QLIV +NK MV L +H P Sbjct: 61 TREHAILVRSLGVTQLIVAINKLDMVVLGYHRGKP 95 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 101 bits (241), Expect = 9e-22 Identities = 43/84 (51%), Positives = 61/84 (72%) Frame = +1 Query: 256 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNG 435 T+++ F+T + T++DAPGH+ F+ NMI+G +QAD VL+++A GEFE G + G Sbjct: 209 TVEVGRAAFDTDTKHFTLLDAPGHKSFVPNMISGATQADLGVLVISARKGEFETGFERGG 268 Query: 436 QTREHALLAFTLGVKQLIVGVNKM 507 QTREHA+LA T GVK L++ VNKM Sbjct: 269 QTREHAMLAKTAGVKHLVILVNKM 292 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/40 (45%), Positives = 28/40 (70%) Frame = +3 Query: 129 YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERD 248 Y G +DKRT+EK+E+EA+E + ++ +W LD + ERD Sbjct: 166 YLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERD 205 Score = 33.9 bits (74), Expect = 0.15 Identities = 11/24 (45%), Positives = 21/24 (87%) Frame = +3 Query: 525 YSEPRFEEIKKEVSSYIKKIGYNP 596 ++E R+EEIK +++ ++KK+G+NP Sbjct: 299 WNEERYEEIKVKLTPFLKKVGFNP 322 >SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) Length = 106 Score = 98.7 bits (235), Expect = 5e-21 Identities = 51/74 (68%), Positives = 54/74 (72%) Frame = +3 Query: 45 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 224 M KEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE+ E+ S + Sbjct: 1 MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEVLCFS-SCLLFM 59 Query: 225 DKLKAERDXVHNRY 266 KLK E H Y Sbjct: 60 SKLKFELPCTHKIY 73 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 80.2 bits (189), Expect = 2e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 256 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 366 TIDIALWKFET KYYVT+IDAPGHRDFIKNMITGTSQ Sbjct: 24 TIDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQ 60 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +3 Query: 189 MGKGSFKYAWVLDKLKAERD 248 MGKGSFKYAWVLDKLKAER+ Sbjct: 1 MGKGSFKYAWVLDKLKAERE 20 >SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +1 Query: 301 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 405 +T ID PGH F G + D VL+VAA G Sbjct: 78 ITFIDTPGHAAFNSMRARGANVTDIVVLVVAADDG 112 >SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 833 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +3 Query: 45 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 140 M K+ N+ VI HVD GKST T L+ K G Sbjct: 12 MDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAG 43 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 295 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 405 + + +ID+PGH DF + D A+++V +G Sbjct: 99 FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 135 >SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26) Length = 541 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/66 (25%), Positives = 30/66 (45%) Frame = +1 Query: 310 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 489 +D PGH + M+ G + D A+L++A QT EH + +K ++ Sbjct: 69 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 122 Query: 490 VGVNKM 507 + NK+ Sbjct: 123 ILQNKI 128 >SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) Length = 783 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 307 IIDAPGHRDFIKNMITGTSQADCAVLIV 390 IID PGH F G+S D A+L+V Sbjct: 682 IIDTPGHESFSNLRSRGSSLCDMAILVV 709 >SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 359 Score = 29.9 bits (64), Expect = 2.5 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +1 Query: 301 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 405 + I+D PGH+DF ++ + D ++++ G Sbjct: 81 INILDTPGHKDFAEDTFRTLTAVDSVIVVIDVAKG 115 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 60 THINIVVIGHVDSGKSTTTGHLIY 131 T I + V+G+V+SGKST G L Y Sbjct: 111 TDIRMAVLGNVESGKSTLLGVLTY 134 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 69 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 167 N ++ HVD GKST L+ G I K + K Sbjct: 1943 NFSIVAHVDHGKSTLADRLLEVTGTISKSSDNK 1975 >SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +3 Query: 465 HPRCQTAHRRSKQNGSTEPPYSEPRFEEIKKEVSSYIKKIGYN 593 H + + RR ++N + + P+FE++K + +S KKI N Sbjct: 109 HETTEPSVRRCQRNSVRDIDAAWPKFEKLKSQFNSNSKKISMN 151 >SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) Length = 240 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/47 (25%), Positives = 19/47 (40%) Frame = +1 Query: 256 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 396 T I + + + +D PGH F G D +++VAA Sbjct: 125 TQHIGAYSVKVGDQKIAFLDTPGHEAFTAMRARGAQVTDLVIIVVAA 171 >SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3112 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Frame = +3 Query: 510 STEPPYSEPRFEEIKKE----VSSYIKKIGYNPA-AVAFVPISGWHGDNMLE 650 ST S+ FE KK +S+ K +P+ + FVP WHG+ M+E Sbjct: 1062 STRANSSQGGFEAKKKSWTKLSASFAKPEVVDPSDKIRFVPAVNWHGEQMIE 1113 >SB_21189| Best HMM Match : PCI (HMM E-Value=8.2) Length = 125 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 5/58 (8%) Frame = +3 Query: 435 SNP*ACLARFHPRC-----QTAHRRSKQNGSTEPPYSEPRFEEIKKEVSSYIKKIGYN 593 +N A L RF C ++A RR ++N + + P+F+ +K + S KKI N Sbjct: 25 NNEFAALKRFLKNCMHETTESAVRRCQRNSVMDIDAAWPKFQRLKSQFSINSKKISMN 82 >SB_43213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 683 PSLEPRHFG*RLQHVVSVPSRNGHESDSSWVVANLLD 573 P+LEP + G L + S S GH+ D+ ++ LL+ Sbjct: 378 PNLEPSYIGKMLATIESTLSAKGHQEDAEEFLSCLLN 414 >SB_37907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 465 HPRCQTAHRRSKQNGSTEPPYSEPRFEEIKKEVSSYIKKIGYN 593 H ++A RR ++N + + P+F+ +K + S KKI N Sbjct: 8 HETTESAVRRCQRNSVMDIDAAWPKFQRLKSQFSINSKKISMN 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,251,910 Number of Sequences: 59808 Number of extensions: 513533 Number of successful extensions: 1424 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1422 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -