BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0576 (642 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical pr... 29 2.8 AL132949-25|CAB61103.1| 209|Caenorhabditis elegans Hypothetical... 27 8.6 >Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical protein F08H9.1 protein. Length = 607 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -1 Query: 402 RSPHENIEVLSVVEDSEDFD 343 R+P+ENI++L +DSED D Sbjct: 581 RAPYENIDLLLSTDDSEDID 600 >AL132949-25|CAB61103.1| 209|Caenorhabditis elegans Hypothetical protein Y53F4B.29 protein. Length = 209 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = -1 Query: 498 GQVETLAVGSVEARGSKSVDEHASVDPFSHPARSPHENIEVLSVVEDSEDFDGFF 334 GQV L+V E S ++ + + + F + ++P E ++V+ +DF G F Sbjct: 51 GQVPVLSVDGFEIPQSAAIIRYLA-NKFGYAGKTPEEQAWADAIVDQFKDFMGSF 104 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,409,329 Number of Sequences: 27780 Number of extensions: 262086 Number of successful extensions: 645 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -