BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0565 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03220.1 68415.m00275 galactoside 2-alpha-L-fucosyltransferas... 31 0.67 At1g27320.1 68414.m03328 histidine kinase (AHK3) identical to hi... 29 2.7 At1g07000.1 68414.m00745 exocyst subunit EXO70 family protein si... 29 2.7 At3g63330.1 68416.m07125 protein kinase family protein contains ... 29 3.6 At3g30550.1 68416.m03866 hypothetical protein includes At2g05890... 28 4.7 At4g20850.1 68417.m03025 subtilase family protein contains simil... 28 6.2 At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF... 28 6.2 At5g60900.1 68418.m07640 lectin protein kinase family protein co... 27 8.2 At2g29060.1 68415.m03532 scarecrow transcription factor family p... 27 8.2 >At2g03220.1 68415.m00275 galactoside 2-alpha-L-fucosyltransferase / xyloglucan alpha-(1,2)-fucosyltransferase (FUT1) (FT1) identical to SP|Q9SWH5 Galactoside 2-alpha-L-fucosyltransferase (EC 2.4.1.69) (Xyloglucan alpha-(1,2)-fucosyltransferase) (AtFUT1) {Arabidopsis thaliana} Length = 558 Score = 31.1 bits (67), Expect = 0.67 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +3 Query: 138 IIADYDSAVERSKLIYTD-NKGELITNVVNNLIRNNKMNCWSTPTSSG 278 ++ + D+ VERS+ + T +K L+T++ N K W PTS+G Sbjct: 391 LLPEVDTLVERSRHVNTPKHKAVLVTSLNAGYAENLKSMYWEYPTSTG 438 >At1g27320.1 68414.m03328 histidine kinase (AHK3) identical to histidine kinase AHK3 [Arabidopsis thaliana] gi|13537198|dbj|BAB40775 Length = 1036 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +3 Query: 153 DSAVERSKLIYTDNKGELITNVVNNLIRNNKMNCWSTPTSSGCKAPRTS 299 D+ +E + + G+L + L + NKM W+ +SSG K P S Sbjct: 30 DNGIEDKSGLLVGSVGDLEKTKMTTLKKKNKMWFWNKISSSGLKIPSFS 78 >At1g07000.1 68414.m00745 exocyst subunit EXO70 family protein similar to leucine zipper protein GI:10177020 from [Arabidopsis thaliana] contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 599 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 134 VIVKMLRQDFVEGCAFVGVQRRREKTQDNNSGLHLR 27 + V+M+ F + C+ V RRRE +++ S LHLR Sbjct: 192 IAVRMVAGGFAKECSRVYSSRRREFLEESLSRLHLR 227 >At3g63330.1 68416.m07125 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 376 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 5/59 (8%) Frame = +3 Query: 117 EHLYNDVIIADYDSAVERSKLIYTDNKGELITNVV-----NNLIRNNKMNCWSTPTSSG 278 E YND+ + + V SKL+YT + E+ + ++R +K W T SG Sbjct: 65 ESRYNDIWLVFHHEGVSLSKLMYTVEEAEISSEKAEEASHGQILRPSKWWTWLKTTESG 123 >At3g30550.1 68416.m03866 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 509 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/66 (21%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +3 Query: 30 KMKSAVVVLCLFAASLYAD-EGTAFNEILAEHLYNDVIIADYDSAVERSKLIYTDNKGEL 206 K K+ +LC+ +++ + + +++ ++++ DYD+ V+ S LI + + Sbjct: 398 KGKTFQFLLCVQRENIFGGYDSFTVARVYTDNIADEIVQEDYDAYVDPSSLISIEQDSLM 457 Query: 207 ITNVVN 224 +TN V+ Sbjct: 458 LTNGVD 463 >At4g20850.1 68417.m03025 subtilase family protein contains similarity to Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) (Swiss-Prot:P29144) [Homo sapiens] Length = 1380 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -2 Query: 119 LRQDFVEGCAFVGVQRRREKTQDNNSGLHLRSAGFFGSP 3 L +DF+ F+ +R R ++ + G+ LR +GF P Sbjct: 32 LPRDFISSSTFLLHRRLRRRSCSRSRGIRLRRSGFSAMP 70 >At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF) identical to alpha-glucosidase I (GI:16506680, GI:13398928) [Arabidopsis thaliana] Length = 852 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 165 ERSKLIYTDNKGELITNVVNN 227 E+SK IYT+ + LI NVV N Sbjct: 790 EKSKAIYTELRSNLIRNVVRN 810 >At5g60900.1 68418.m07640 lectin protein kinase family protein contains Pfam domains, PF01453: Lectin (probable mannose binding) and PF00069: Protein kinase domain Length = 748 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 215 CRKQSDTKQQDELLEYAYQLWMQGS-EDIVRDCFPVEFTLILAENYVKL 358 C+K D + L+ +AY + QG ED+ D + E YVK+ Sbjct: 645 CKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKI 693 >At2g29060.1 68415.m03532 scarecrow transcription factor family protein Length = 1336 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +2 Query: 377 LAFTLSDNGGVAYGDSKDRTSSRVSWKFIPLWENNK 484 LA +S GG +Y S TSS W F L ENN+ Sbjct: 116 LAQLVSSPGGSSYASSTTTTSSDSQWSFDCL-ENNR 150 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,837,034 Number of Sequences: 28952 Number of extensions: 244536 Number of successful extensions: 685 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -