BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0560 (634 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0359 - 2633735-2634115,2634345-2634600,2634708-2635552,263... 27 9.4 06_03_1511 - 30669292-30669401,30669894-30669930,30670012-306701... 27 9.4 >07_01_0359 - 2633735-2634115,2634345-2634600,2634708-2635552, 2635681-2635956,2636778-2636941,2637924-2638197 Length = 731 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 577 TGSLAALVIFIIKALLMTWLSTK 509 T L + VIF++ L+ TWLS++ Sbjct: 8 TSLLTSFVIFVVLVLVFTWLSSR 30 >06_03_1511 - 30669292-30669401,30669894-30669930,30670012-30670107, 30670186-30670281,30670679-30670828,30670956-30671100, 30671178-30671251,30671325-30671445,30671697-30671821, 30671898-30672047,30672249-30672324,30672496-30672557, 30672597-30672839,30673354-30673683,30673776-30673932, 30674008-30674139,30674219-30674277,30674734-30674798, 30674878-30675094,30675413-30675499,30675655-30675750, 30675938-30676003,30676096-30676287,30676380-30676532, 30676812-30677052,30677322-30677515,30678212-30678348, 30678474-30678480,30678708-30678830,30679370-30679427, 30680018-30680090,30680493-30681765 Length = 1714 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/71 (25%), Positives = 32/71 (45%) Frame = +2 Query: 56 GYGTMVFTKEPMVNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYNIEKSCDKYMNVD 235 G M+F + +V ++K K C + + + T E +KE+ KE +I ++ VD Sbjct: 967 GVKGMLFEEFSVVEEELK-KSFCRKQASEALATQTSMEVVKEVLKEASILTIEEEQPFVD 1025 Query: 236 VVKQFMGCIRW 268 + I W Sbjct: 1026 LSHNLKAAITW 1036 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,888,109 Number of Sequences: 37544 Number of extensions: 342001 Number of successful extensions: 970 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 970 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -