BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0559 (657 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0260 - 13580396-13582990 29 2.5 02_01_0352 - 2542088-2542985,2543523-2543563,2543798-2543950 29 2.5 10_07_0091 - 12774590-12774664,12774971-12775134,12775249-127753... 28 7.5 >04_03_0260 - 13580396-13582990 Length = 864 Score = 29.5 bits (63), Expect = 2.5 Identities = 21/70 (30%), Positives = 34/70 (48%) Frame = -2 Query: 539 HXPGHAQXLLQLTPGTCSVTTIVXIMPTKATTSLAASEVSSSKCFLLRTLLSPLLKAMIA 360 H A +QLTP + + T PT+ T+S A ++ S+K ++ +L L A I Sbjct: 452 HYNSSAYLKVQLTPSSAAPTQNSSSAPTQ-TSSFALTQNKSNK---MKAILGSTLAASIT 507 Query: 359 IVFPIIPIAY 330 +V I + Y Sbjct: 508 LVLVAIIVVY 517 >02_01_0352 - 2542088-2542985,2543523-2543563,2543798-2543950 Length = 363 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 285 LHQQTAVIWDRREDRVRYRNNWEHYSYHRFEERRE 389 LH Q DR ++ RYR N+ + H +R E Sbjct: 281 LHSQFTSYGDRNSEQCRYRRNYSCHKIHHLTKRTE 315 >10_07_0091 - 12774590-12774664,12774971-12775134,12775249-12775382, 12775463-12775556,12775650-12775758,12776055-12776103, 12778336-12778376,12779539-12779571,12779665-12779754, 12780474-12780507,12781218-12781510,12781859-12782057, 12782129-12782289,12783130-12783282,12783545-12783715, 12783822-12783921,12784023-12784111,12784192-12784290, 12784406-12784676,12784764-12784961,12785041-12785140, 12785799-12785931,12786016-12786277,12787106-12787155 Length = 1033 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 262 FDSCPEVKLGEV*WCRLSEVQSYDVLHGGGA 170 FDSCP++K+ ++ C+ S D L+ GA Sbjct: 655 FDSCPQLKILKLSACKYLSDSSLDALYREGA 685 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,683,631 Number of Sequences: 37544 Number of extensions: 197956 Number of successful extensions: 434 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -