BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0558 (599 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006CF2F0 Cluster: hypothetical protein TTHERM_0006... 35 1.7 UniRef50_O96306 Cluster: Adenylyl cyclase isoform DAC39E; n=7; D... 33 3.9 UniRef50_Q9G8N7 Cluster: Haem lyase; n=1; Naegleria gruberi|Rep:... 33 6.8 UniRef50_Q32S10 Cluster: Protein involved in cytochrome c biogen... 32 9.0 >UniRef50_UPI00006CF2F0 Cluster: hypothetical protein TTHERM_00061590; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00061590 - Tetrahymena thermophila SB210 Length = 1040 Score = 34.7 bits (76), Expect = 1.7 Identities = 18/37 (48%), Positives = 25/37 (67%) Frame = -2 Query: 307 LHKKCLTLILTFYSIYLYFINKIRSIGLMKNLSTFQG 197 L++K L+L FYSI +YF K++S + N STFQG Sbjct: 772 LNEKLTFLLLQFYSISVYFYFKLQSQNIQDN-STFQG 807 >UniRef50_O96306 Cluster: Adenylyl cyclase isoform DAC39E; n=7; Diptera|Rep: Adenylyl cyclase isoform DAC39E - Drosophila melanogaster (Fruit fly) Length = 1167 Score = 33.5 bits (73), Expect = 3.9 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -1 Query: 341 IYHNYTIKQRNSAQKMFNFNSHVLFNI 261 +YHNY+IKQR S K F F + LFNI Sbjct: 57 LYHNYSIKQRRSGLKWFVF-AAALFNI 82 >UniRef50_Q9G8N7 Cluster: Haem lyase; n=1; Naegleria gruberi|Rep: Haem lyase - Naegleria gruberi Length = 474 Score = 32.7 bits (71), Expect = 6.8 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = -1 Query: 377 FQTFELNMYNIYIYHNYTIKQRNSAQKMFNFNSHVLFNISVFY 249 F+ E N+YN YI++NY +N+ +++ N+ ++ I + Y Sbjct: 428 FEKIEFNIYN-YIFNNYYYNIKNNVIQIYKLNNIIVLFILILY 469 >UniRef50_Q32S10 Cluster: Protein involved in cytochrome c biogenesis; n=1; Staurastrum punctulatum|Rep: Protein involved in cytochrome c biogenesis - Staurastrum punctulatum (Green alga) Length = 381 Score = 32.3 bits (70), Expect = 9.0 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = -1 Query: 383 VFFQTFELNMYNIYIYHNYTIKQRNSAQKMFNFNS 279 +FF T + + I +Y N TI N++QK+F+F++ Sbjct: 17 IFFLTTLFSWFKITLYENKTICSTNNSQKIFSFSN 51 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 479,428,238 Number of Sequences: 1657284 Number of extensions: 8499950 Number of successful extensions: 13748 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13745 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 42317807226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -