BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0558 (599 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29097-8|AAA68415.1| 341|Caenorhabditis elegans Serpentine rece... 33 0.16 U64608-3|AAB04593.2| 349|Caenorhabditis elegans Serpentine rece... 28 5.9 U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical pr... 27 7.7 >U29097-8|AAA68415.1| 341|Caenorhabditis elegans Serpentine receptor, class a (alpha)protein 28 protein. Length = 341 Score = 33.1 bits (72), Expect = 0.16 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -2 Query: 295 CLTLILTFYSIYLYFINKIRSIGLMKNLSTFQGEFK 188 C+ ++L F++I+LY NKIR ++ N+ +K Sbjct: 194 CVLIVLLFFAIFLYIHNKIREKRMVHNVYNINSRYK 229 >U64608-3|AAB04593.2| 349|Caenorhabditis elegans Serpentine receptor, class v protein7 protein. Length = 349 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 280 ELKLNIFCAELRCFMV*LWYIYILYIFSSNV*KKTVVH*ILF 405 E LNI A L C ++Y Y++Y+F N T V +L+ Sbjct: 235 EYNLNIVAA-LTCVAEIIYYCYVIYVFGINTSVPTRVFYLLY 275 >U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical protein C41A3.1 protein. Length = 7829 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = -1 Query: 539 FIVNNCMYRNYLNFKILIIEKHIMIVLLS*KNKLFYW*IKFY 414 + +NN +++ L F+IL +E+ + IVL S + + I FY Sbjct: 6905 YFMNNALFKTSLPFEILRLEEILNIVLNSLEKSRSFATIPFY 6946 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,718,998 Number of Sequences: 27780 Number of extensions: 219946 Number of successful extensions: 371 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -