BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0557 (634 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 83 2e-16 SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 79 4e-15 SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 46 3e-05 SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 46 3e-05 SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) 35 0.048 SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) 33 0.25 SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) 30 1.8 SB_47074| Best HMM Match : Ion_trans (HMM E-Value=2.5e-38) 29 2.4 SB_18529| Best HMM Match : DUF1388 (HMM E-Value=3.5) 29 4.1 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_35966| Best HMM Match : CpaB (HMM E-Value=3.6) 28 5.5 SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) 28 5.5 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 28 7.2 SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) 28 7.2 SB_24839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_3| Best HMM Match : Peptidase_C21 (HMM E-Value=5) 28 7.2 SB_35062| Best HMM Match : IATP (HMM E-Value=1.7) 27 9.6 SB_7977| Best HMM Match : MOZ_SAS (HMM E-Value=3.4e-21) 27 9.6 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 27 9.6 >SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 725 Score = 83.0 bits (196), Expect = 2e-16 Identities = 41/90 (45%), Positives = 54/90 (60%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG 434 SYS+F+ LFD I+E YH +K DKH + T NLDP G F+ STR+R R+L+G Sbjct: 441 SYSLFSPLFDKIVEHYHAPYKLADKHTSDMNPEKVTAPNLDPDGVFIRSTRIRVARNLKG 500 Query: 435 YPFNPCLTEXQXKEMEDKVSGTLSSFEGEL 524 Y P LT + E+E KV+ L S G+L Sbjct: 501 YALTPGLTRKERNEIEKKVTEVLCSLTGDL 530 Score = 70.5 bits (165), Expect = 1e-12 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 1/73 (1%) Frame = +1 Query: 28 KAATMVDAATLEKLEAGFSK-LQGSDSKSXLKXYLTREVFDSLKNKKTSFGSTLLDCIQS 204 K+ ++ A +EK + F + L + KS LK YLT E+F+SLK+KKT+ G +L DCI S Sbjct: 337 KSLLEIERAAIEKQRSVFPEALNKEECKSLLKKYLTAEMFNSLKDKKTAKGISLYDCINS 396 Query: 205 GVENLDSGVGIYA 243 GV NLDS G+YA Sbjct: 397 GVVNLDSSCGVYA 409 Score = 60.1 bits (139), Expect = 1e-09 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG 434 SY+VFA LFD +IEDYH+ +K D H D +LDP F+ STR+R GR L G Sbjct: 94 SYTVFAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAPDLDPDNRFIRSTRIRVGRDLAG 153 Query: 435 --YP 440 YP Sbjct: 154 KYYP 157 Score = 35.5 bits (78), Expect = 0.036 Identities = 29/77 (37%), Positives = 35/77 (45%), Gaps = 5/77 (6%) Frame = +1 Query: 40 MVDAATLEKLEAGFS-----KLQGSDSKSXLKXYLTREVFDSLKNKKTSFGSTLLDCIQS 204 M DAA EK + + K + K LK YLT +VFD LK KKT G Sbjct: 8 MADAAEAEKYRSKNAYPVPLKSAKCNPKCLLKKYLTNQVFDQLKTKKTKRGDGGCSDGGG 67 Query: 205 GVENLDSGVGIYAPDAD 255 G ++D G Y DAD Sbjct: 68 GGGDVDDDDGEYI-DAD 83 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 542 PSXGMXKEXQQQLIDDXFLFNEGE 613 P GM + +Q+L+DD FLF +G+ Sbjct: 536 PLTGMDEATRQKLVDDHFLFKKGD 559 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 515 GRAQXXRSTPSXGMXKEXQQQLIDDXFLFNEGE 613 GR + P GM + ++QL++D FLF +G+ Sbjct: 148 GRDLAGKYYPLTGMDEVTREQLVNDHFLFKKGD 180 >SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 969 Score = 78.6 bits (185), Expect = 4e-15 Identities = 39/89 (43%), Positives = 51/89 (57%) Frame = +3 Query: 258 YSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGY 437 Y VF ELFD IIEDYH +K + H + NLD G F+ STR+R R+L+GY Sbjct: 687 YEVFGELFDKIIEDYHAPYKLEENHKSDMDPEKVDAPNLDAEGAFIRSTRIRVARNLKGY 746 Query: 438 PFNPCLTEXQXKEMEDKVSGTLSSFEGEL 524 P LT + ++E KV G L+S G+L Sbjct: 747 ALTPGLTRKERVDVESKVVGVLNSLTGDL 775 Score = 78.2 bits (184), Expect = 5e-15 Identities = 38/90 (42%), Positives = 51/90 (56%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG 434 SY +FA LFD IIEDYH +K KH + +LDP G F+ STR+R R+L+G Sbjct: 254 SYKLFAPLFDKIIEDYHAPYKLEQKHTSDMNPEKVEAPDLDPEGSFIRSTRIRVARNLKG 313 Query: 435 YPFNPCLTEXQXKEMEDKVSGTLSSFEGEL 524 Y P L++ E+E+KV S G+L Sbjct: 314 YALTPALSKKARLEIEEKVKNVFESLTGDL 343 Score = 74.1 bits (174), Expect = 8e-14 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 1/72 (1%) Frame = +1 Query: 43 VDAATLEKLEAGFSK-LQGSDSKSXLKXYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL 219 ++ A +E+ F + L+ + KS LK YLT +VF+SLK KKTS G+ L DCI SGV NL Sbjct: 614 IERAAIEEAHLKFPEDLKKPEVKSLLKKYLTEDVFNSLKEKKTSRGAGLYDCINSGVVNL 673 Query: 220 DSGVGIYAPDAD 255 DSG G+YA D + Sbjct: 674 DSGTGVYAADEE 685 Score = 73.3 bits (172), Expect = 1e-13 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = +1 Query: 43 VDAATLEKLEAGFSK-LQGSDSKSXLKXYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL 219 ++ A +E F + L+ + KS +K YLT E+F+ LK+KKT G TL DCI SGVENL Sbjct: 182 IEKAAVEAKRNVFPEVLKKPEVKSLMKKYLTEEMFNELKDKKTELGVTLSDCINSGVENL 241 Query: 220 DSGVGIYAPDAD 255 DSG GIYA D + Sbjct: 242 DSGTGIYAGDEE 253 Score = 31.1 bits (67), Expect = 0.78 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 542 PSXGMXKEXQQQLIDDXFLFNEGE 613 P GM + +QQL+DD FLF +G+ Sbjct: 781 PLSGMDEATRQQLVDDHFLFKKGD 804 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 542 PSXGMXKEXQQQLIDDXFLFNE 607 P GM +E +QQL++D FLF + Sbjct: 349 PLDGMTEETRQQLVNDHFLFKK 370 >SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 77.8 bits (183), Expect = 7e-15 Identities = 39/85 (45%), Positives = 51/85 (60%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG 434 SY+VFA LFD +IEDYH+ +K D H D +LDP F+ STR+R GR+L+G Sbjct: 233 SYTVFAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAPDLDPDNRFIRSTRIRVGRNLKG 292 Query: 435 YPFNPCLTEXQXKEMEDKVSGTLSS 509 Y P LT+ + E+E K S T S Sbjct: 293 YGLAPSLTKKERVELEKKASFTAKS 317 Score = 34.3 bits (75), Expect = 0.083 Identities = 22/50 (44%), Positives = 25/50 (50%) Frame = +1 Query: 106 KSXLKXYLTREVFDSLKNKKTSFGSTLLDCIQSGVENLDSGVGIYAPDAD 255 K LK YLT +VFD LK KKT G G ++D G Y DAD Sbjct: 174 KCLLKKYLTNQVFDQLKTKKTKRGDGGCSDGGGGGGDVDDDDGEYI-DAD 222 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 76.6 bits (180), Expect = 2e-14 Identities = 39/91 (42%), Positives = 54/91 (59%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG 434 SY FAELFDP+IE+ H+GFKK+DKH G D ++V+S+RVR GRS+ G Sbjct: 114 SYDTFAELFDPVIEERHSGFKKSDKHKTDLDSSKIRGGKFDE--KYVLSSRVRTGRSIRG 171 Query: 435 YPFNPCLTEXQXKEMEDKVSGTLSSFEGELN 527 + P T + +E+E V+ L G+LN Sbjct: 172 FSLPPHCTRAERREVERIVNDALDGLGGDLN 202 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 542 PSXGMXKEXQQQLIDDXFLFNE 607 P GM QQQLIDD FLF++ Sbjct: 207 PLNGMSDAQQQQLIDDHFLFDK 228 Score = 29.1 bits (62), Expect = 3.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +1 Query: 124 YLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAD 255 +LT ++ L++K T G TL IQ+GV+N S VG+ A D + Sbjct: 66 HLTPRLYVKLRDKSTPNGYTLDQAIQTGVDNPGHPFISTVGLVAGDEE 113 >SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 72.1 bits (169), Expect = 3e-13 Identities = 38/91 (41%), Positives = 52/91 (57%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG 434 SY VFA+LFDP+IE+ HNG+KKTDKH G+ D +V+STR R GRS+ G Sbjct: 455 SYDVFADLFDPVIEERHNGYKKTDKHVTDLNHRKLKGGSFDE--RYVLSTRCRTGRSIRG 512 Query: 435 YPFNPCLTEXQXKEMEDKVSGTLSSFEGELN 527 + P T + + +E V L G+L+ Sbjct: 513 FSLPPHCTRAERRSVEKVVVDALDQLGGDLS 543 Score = 27.5 bits (58), Expect = 9.6 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +1 Query: 124 YLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAD 255 +L+ ++ LK+K T G TL IQ+GV+N S VG+ A D + Sbjct: 407 HLSPRLYTKLKDKVTPNGYTLDMAIQTGVDNPGHPFISTVGLVAGDEE 454 >SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1115 Score = 72.1 bits (169), Expect = 3e-13 Identities = 36/90 (40%), Positives = 54/90 (60%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG 434 SY VFA++FDP+IE HNG+KKT KH + + +G D ++V+S RVR GRS+ G Sbjct: 421 SYDVFADMFDPVIEKRHNGYKKTAKH-KTDLNPSNLIGGDDLDEKYVLSCRVRTGRSIRG 479 Query: 435 YPFNPCLTEXQXKEMEDKVSGTLSSFEGEL 524 P + + +E+E V+ L+ +G L Sbjct: 480 LCLPPWCSRAERREVEKIVTSALAELDGPL 509 Score = 68.5 bits (160), Expect = 4e-12 Identities = 36/89 (40%), Positives = 51/89 (57%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG 434 SY VFA++FDP+IE H+G++KTD H D +G D ++V+S RVR GRS+ G Sbjct: 52 SYDVFADMFDPVIEKRHDGYRKTDMHKTDLNPD-HLIGGDDLDEKYVLSCRVRTGRSIRG 110 Query: 435 YPFNPCLTEXQXKEMEDKVSGTLSSFEGE 521 P T + +E+E L S +GE Sbjct: 111 LGLPPHCTRAERREVEKVSVEALDSLDGE 139 Score = 61.7 bits (143), Expect = 5e-10 Identities = 35/90 (38%), Positives = 48/90 (53%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG 434 +Y VFA L DP+IE HNG+ K KH D + +G D FV+S RVR GRS+ G Sbjct: 818 TYKVFAALLDPVIEARHNGYLKGAKHVTDLNPD-NLVGGDDLDANFVLSCRVRTGRSIRG 876 Query: 435 YPFNPCLTEXQXKEMEDKVSGTLSSFEGEL 524 P T + +E+E L++ +G L Sbjct: 877 LGLPPHCTRAERREVEKITVDALATLDGPL 906 Score = 35.5 bits (78), Expect = 0.036 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = +1 Query: 22 ARKAATMVDAATLEKLEAGFSKLQGSD-SKSXLKXYLTREVFDSLKNKKTSFGSTLLDCI 198 AR+ A +A +K + ++ G + ++ + +LTR+V++ L N KT G TL I Sbjct: 736 AREEAIKKEAER-QKASSTLRRVPGPEQAQHYMAKFLTRDVYNKLCNLKTPSGFTLDGVI 794 Query: 199 QSGVEN 216 Q+GV+N Sbjct: 795 QTGVDN 800 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 127 LTREVFDSLKNKKTSFGSTLLDCIQSGVEN 216 +T++V+ L N +T G TL IQ+GV+N Sbjct: 5 MTKDVYQRLSNLRTPSGYTLDMAIQTGVDN 34 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 69.7 bits (163), Expect = 2e-12 Identities = 38/89 (42%), Positives = 52/89 (58%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG 434 SY VFAEL DP+IE H G+KKTDKH D G LDP ++V+S+RVR GRS+ G Sbjct: 2374 SYDVFAELLDPVIELRHGGYKKTDKHKTDLNPDNLKGGALDP--KYVLSSRVRTGRSIRG 2431 Query: 435 YPFNPCLTEXQXKEMEDKVSGTLSSFEGE 521 + P + + + +E L+ +GE Sbjct: 2432 FCLPPHCSRAERRSVEKISVDALAKLDGE 2460 Score = 36.3 bits (80), Expect = 0.021 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = +1 Query: 127 LTREVFDSLKNKKTSFGSTLLDCIQSGVEN 216 LT+E++ SL++K T G TL D IQ+GV+N Sbjct: 2327 LTKEIYRSLRDKSTKNGFTLDDIIQTGVDN 2356 >SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 309 Score = 46.0 bits (104), Expect = 3e-05 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 1/91 (1%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFK-KTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 431 SY F + + P+I+ YH GF T KH + + D A ++STR+R R+L Sbjct: 10 SYDDFKDFYYPVIQAYHKGFDINTSKHVTDMDPEKISTELSDSAKAKIISTRIRVARNLS 69 Query: 432 GYPFNPCLTEXQXKEMEDKVSGTLSSFEGEL 524 +P NP ++ E+ D ++ S +L Sbjct: 70 MFPLNPGGSKESRLEIIDLMAKVYDSLGDDL 100 >SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 383 Score = 46.0 bits (104), Expect = 3e-05 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 1/91 (1%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFK-KTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLE 431 SY F + + P+I+ YH GF T KH + + D A ++STR+R R+L Sbjct: 102 SYDDFKDFYYPVIQAYHKGFDINTSKHVTDMDPEKISTELSDSAKAKIISTRIRVARNLS 161 Query: 432 GYPFNPCLTEXQXKEMEDKVSGTLSSFEGEL 524 +P NP ++ E+ D ++ S +L Sbjct: 162 MFPLNPGGSKESRLEIIDLMAKVYDSLGDDL 192 >SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) Length = 322 Score = 35.1 bits (77), Expect = 0.048 Identities = 21/55 (38%), Positives = 30/55 (54%) Frame = +3 Query: 354 VDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTEXQXKEMEDKVSGTLSSFEG 518 V G LD VVS RVR RSL+G+PF + + +E+++ V L S +G Sbjct: 270 VGVTGTLDA---HVVSCRVRVVRSLQGFPFAWVCSPNERREIQNVVKQALDSLKG 321 >SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) Length = 490 Score = 32.7 bits (71), Expect = 0.25 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = +3 Query: 354 VDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTEXQXKEMEDKVSGTLSSFE 515 V G LD VVS RVR RSL+G+PF + + +E+++ V L S + Sbjct: 279 VGVTGTLDA---HVVSCRVRVVRSLQGFPFAWVCSPNERREIQNVVKQALDSLK 329 >SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) Length = 132 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +1 Query: 124 YLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 216 +LT E++ L ++KTS G TL IQ GV+N Sbjct: 82 HLTPEMYVHLCDRKTSNGFTLDQAIQPGVDN 112 >SB_47074| Best HMM Match : Ion_trans (HMM E-Value=2.5e-38) Length = 467 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +1 Query: 115 LKXYLTREVFDSLKNKKTSFGSTLLDCIQSGVENLDSGVGIYAPDADRT 261 +K ++ VF++ + + TLL C Q V LD G Y D D++ Sbjct: 41 IKINVSGMVFETYEETLAQYPQTLLGCPQKRVRYLDPNSGEYCFDRDKS 89 >SB_18529| Best HMM Match : DUF1388 (HMM E-Value=3.5) Length = 435 Score = 28.7 bits (61), Expect = 4.1 Identities = 25/100 (25%), Positives = 41/100 (41%) Frame = +2 Query: 29 KPQQWSTPQPSRNWRLVSASSRDPTLSRC*RXTLPGKYSTA*RTKRPHSDPPSLTASNRV 208 +P+Q S P+P N + +S SR + +L K S +T R ++ T ++R Sbjct: 154 RPRQASRPRPRGNTKTSRKTSHKTETSRKTKTSLKTKTSLKTKTSR-NTKTSRKTKTSRK 212 Query: 209 SRTWTPASVSTRRTPIVLRVRRAV*PDHRGLPQWLQEDRQ 328 ++T R R R+A P P+ RQ Sbjct: 213 TKTKPQDQDQAARPSQAARPRQAARPRQASRPRQAARPRQ 252 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -1 Query: 442 KGYPSSERPQRTRVETTNS-PAGSRLPSVSTSP 347 +G SSERP+R+R T + P S LP +++P Sbjct: 1178 RGSLSSERPERSRRRRTETEPRDSSLPCTASTP 1210 >SB_35966| Best HMM Match : CpaB (HMM E-Value=3.6) Length = 277 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = -2 Query: 132 GKVXLQXRLRVGSLELAETSLQFLEGCGVDH 40 G + + R+++GS +LA+ L+ L+G G++H Sbjct: 211 GPLRVVLRVQIGSCDLADEHLRKLDGGGLEH 241 >SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) Length = 362 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 233 PTPESKFSTPDWMQSRRVDPNEVFLFFRLSNTS 135 P P+ KFS P + SR +D E L F L+ S Sbjct: 5 PKPKEKFSEPVIIASRNLDSVEARLAFNLTTVS 37 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 27.9 bits (59), Expect = 7.2 Identities = 21/65 (32%), Positives = 30/65 (46%) Frame = +1 Query: 28 KAATMVDAATLEKLEAGFSKLQGSDSKSXLKXYLTREVFDSLKNKKTSFGSTLLDCIQSG 207 KAA + + L KL AG++ L D+ L LT E LK K S + +Q Sbjct: 195 KAAVQLLKSVLPKLTAGYADLYHGDA---LVEVLTTEWHGDLKEKYPQDVSGIYQLVQGQ 251 Query: 208 VENLD 222 +E+ D Sbjct: 252 LESRD 256 >SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) Length = 617 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 5 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLS 109 LT V+VP+ Q +T RN + S+S+ DP L+ Sbjct: 534 LTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLT 568 >SB_24839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 5 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLS 109 LT V+VP+ Q +T RN + S+S+ DP L+ Sbjct: 70 LTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLT 104 >SB_3| Best HMM Match : Peptidase_C21 (HMM E-Value=5) Length = 186 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 255 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNW-GDVDT 362 +Y + F+P +DY NG++ TD H W G++ T Sbjct: 89 TYEQISITFEPY-QDYANGYRATDLHGKVAWVGELST 124 >SB_35062| Best HMM Match : IATP (HMM E-Value=1.7) Length = 223 Score = 27.5 bits (58), Expect = 9.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Frame = -3 Query: 296 LDDRVKQLGEHGVRSASGA*IPTPESKFSTPDWMQ----SRRVDPNEVFLF 156 + + VK L H VRS PE K++ PDW++ +R E F F Sbjct: 33 IGEAVKDLKAHNVRSLD------PEPKYTKPDWLKPTTCRKRTAKTEFFAF 77 >SB_7977| Best HMM Match : MOZ_SAS (HMM E-Value=3.4e-21) Length = 570 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = -3 Query: 290 DRVKQLGEHGVRSASGA*IPTPESKFSTPDWMQSRRVD 177 +RV +L EH RS GA TP S + +W+++ RVD Sbjct: 35 ERVPRLVEH--RSLEGA--YTPSSAWRLDEWVEAARVD 68 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 309 GFKKTDKHPPKNWGDVDTLGNLDPAGEF 392 G K + PP + G+ DT G D GEF Sbjct: 9 GGSKGFRPPPYSCGEFDTRGEFDTCGEF 36 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.132 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,805,501 Number of Sequences: 59808 Number of extensions: 291262 Number of successful extensions: 720 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -