BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0557 (634 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30710.2 68417.m04353 expressed protein contains Pfam domain,... 30 1.5 At4g30710.1 68417.m04352 expressed protein contains Pfam domain,... 30 1.5 At1g18420.1 68414.m02300 expressed protein contains Pfam profile... 30 1.5 >At4g30710.2 68417.m04353 expressed protein contains Pfam domain, PF04484: Family of unknown function (DUF566) Length = 644 Score = 29.9 bits (64), Expect = 1.5 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 6/82 (7%) Frame = +2 Query: 26 EKPQQWSTPQPSRNWRLVSASSRDPTLSRC*RXTLPGKYSTA*RTKRPHSDPPSLTASNR 205 E ++ +P P++N R S S PT+S ++ K + + KRP S PPS T+ + Sbjct: 31 EVSSRYRSPTPTKNGRCPSPSVTRPTVSSS-SQSVAAKRAVSAERKRP-STPPSPTSPST 88 Query: 206 VSRTWT---PAS---VSTRRTP 253 R + PAS +ST R P Sbjct: 89 PIRDLSIDLPASSRRLSTGRLP 110 >At4g30710.1 68417.m04352 expressed protein contains Pfam domain, PF04484: Family of unknown function (DUF566) Length = 644 Score = 29.9 bits (64), Expect = 1.5 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 6/82 (7%) Frame = +2 Query: 26 EKPQQWSTPQPSRNWRLVSASSRDPTLSRC*RXTLPGKYSTA*RTKRPHSDPPSLTASNR 205 E ++ +P P++N R S S PT+S ++ K + + KRP S PPS T+ + Sbjct: 31 EVSSRYRSPTPTKNGRCPSPSVTRPTVSSS-SQSVAAKRAVSAERKRP-STPPSPTSPST 88 Query: 206 VSRTWT---PAS---VSTRRTP 253 R + PAS +ST R P Sbjct: 89 PIRDLSIDLPASSRRLSTGRLP 110 >At1g18420.1 68414.m02300 expressed protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 581 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 303 HNGFKKTDKHPPKNWGDVDTLGNLDPA 383 H + PPKNW DV T NL A Sbjct: 470 HKSQSEATLRPPKNWDDVTTAANLSSA 496 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.315 0.132 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,125,838 Number of Sequences: 28952 Number of extensions: 210443 Number of successful extensions: 539 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 539 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -