BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbpv0551
(650 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AL031633-10|CAA21024.1| 387|Caenorhabditis elegans Hypothetical... 28 6.6
>AL031633-10|CAA21024.1| 387|Caenorhabditis elegans Hypothetical
protein Y39A1A.13 protein.
Length = 387
Score = 27.9 bits (59), Expect = 6.6
Identities = 12/31 (38%), Positives = 19/31 (61%)
Frame = -3
Query: 354 GGYVFSSTNFEKLNAPQQKQFIQTAXNTITH 262
G +VF + +KL PQQ++F+ T + TH
Sbjct: 101 GYFVFLVRDADKLITPQQQKFLYTMVDKATH 131
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,833,091
Number of Sequences: 27780
Number of extensions: 118955
Number of successful extensions: 188
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 187
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 188
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1444744186
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -