BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0546 (535 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 149 1e-38 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 24 0.85 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 1.1 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 4.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 4.5 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 21 7.9 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 7.9 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 149 bits (362), Expect = 1e-38 Identities = 71/76 (93%), Positives = 73/76 (96%) Frame = +3 Query: 15 LMCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIG 194 + CDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIG Sbjct: 58 MKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIG 117 Query: 195 GSIXASLSTFQQMXIS 242 GSI ASLSTFQQM IS Sbjct: 118 GSILASLSTFQQMWIS 133 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 24.2 bits (50), Expect = 0.85 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 487 TLINKNLCQKKNGNNNIPFVLRNMHITIP 401 T I K L KNGN + +++ + IT+P Sbjct: 70 TCIMKLLRTFKNGNFDFDMIVKQLEITMP 98 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.8 bits (49), Expect = 1.1 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = +3 Query: 30 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWI 191 DI++ Y + V MYP + M+K I+ + KI I P E K +WI Sbjct: 349 DIKEMEYLDKVFKETLRMYPPASILMRKAISDYTFNDTKITI--PKEMK--IWI 398 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 59 RIVRWYHHVPWNRRPYAK 112 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 59 RIVRWYHHVPWNRRPYAK 112 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 42 PYGCPRRTSRR 10 P GCPRR R+ Sbjct: 3 PNGCPRRRGRQ 13 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -2 Query: 87 GTWWYHRTIRCWRTSPYGCPRRTSRR 10 G +++ R R W GC R S R Sbjct: 14 GLYYHQRCSRDWFRISAGCVSRISNR 39 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,589 Number of Sequences: 438 Number of extensions: 2982 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -