BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0545 (504 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 2.5 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 2.5 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 24 3.4 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -3 Query: 133 TQHNTTTVMSMITHLTLAE 77 T+HN + + S+I HL++A+ Sbjct: 211 TRHNWSAIYSLIFHLSIAD 229 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -3 Query: 133 TQHNTTTVMSMITHLTLAE 77 T+HN + + S+I HL++A+ Sbjct: 212 TRHNWSAIYSLIFHLSIAD 230 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.8 bits (49), Expect = 3.4 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -2 Query: 212 RRRCLA*SGGRSVPPTDPWRHTPRLQHSTQHYNGYVDDHTLDTR 81 RRRC + T P RH P + ST+ G DD D R Sbjct: 503 RRRCRPRARRNPPATTRPVRHRPTRRKSTK--RGKKDDKGYDRR 544 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 407,298 Number of Sequences: 2352 Number of extensions: 6749 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -