BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0545 (504 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74036-4|CAE17849.1| 112|Caenorhabditis elegans Hypothetical pr... 42 2e-04 AL033514-12|CAA22099.1| 208|Caenorhabditis elegans Hypothetical... 28 4.4 AF106573-5|AAF02104.2| 358|Caenorhabditis elegans Seven tm rece... 27 5.8 >Z74036-4|CAE17849.1| 112|Caenorhabditis elegans Hypothetical protein F55C10.5 protein. Length = 112 Score = 42.3 bits (95), Expect = 2e-04 Identities = 21/55 (38%), Positives = 27/55 (49%) Frame = +1 Query: 328 HVNFSDKGEVKXRRKKFLTAKYGSHHMALIRXXXAVEMWLYDELHFLYEIPKXSN 492 H F D R + LT KYG H MALIR VE W+ E+ L+ + +N Sbjct: 7 HARFGDSKSRMEDRSRVLTMKYGKHQMALIRKRMKVENWIETEVTKLFNGNETNN 61 >AL033514-12|CAA22099.1| 208|Caenorhabditis elegans Hypothetical protein Y75B8A.11 protein. Length = 208 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 151 TLRGCSTQHNT--TTVMSMITHLTLAEAFAVHNVRMRRRC 38 T+ C+++ N T+ S I H L A + +R RRRC Sbjct: 118 TVPACTSKKNVLLTSTTSTINHQKLEPATTLSPIRQRRRC 157 >AF106573-5|AAF02104.2| 358|Caenorhabditis elegans Seven tm receptor protein 79 protein. Length = 358 Score = 27.5 bits (58), Expect = 5.8 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +3 Query: 30 FESHRRRIRTLCTAKASASVKCVIIDITVV 119 F+++R I LC K + ++C +I++T V Sbjct: 309 FKNYRLYILKLCRRKIAQKIRCSVIEMTTV 338 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,778,023 Number of Sequences: 27780 Number of extensions: 143246 Number of successful extensions: 399 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 967231538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -