BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0541 (611 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 23 2.0 AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 21 6.2 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -3 Query: 312 QILSWAXSRFPIRNDFNHCCAIRPRMEKQNAPXTPIKGLIWGTA 181 + LS +P ND C + +AP P +GL+ TA Sbjct: 183 ETLSQLMDVYP-NNDGTKCLVVTDEASISDAPFFPHRGLLLDTA 225 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 516 IEXHSVXLTNSYTVSHAFLSQ 454 + H + LTN+ + H FL + Sbjct: 72 VSFHKLKLTNNISDKHGFLKE 92 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,371 Number of Sequences: 336 Number of extensions: 2300 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -