BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0541 (611 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006617-11|AAF39766.2| 356|Caenorhabditis elegans Serpentine r... 29 3.5 AL021474-3|CAD54163.1| 519|Caenorhabditis elegans Hypothetical ... 28 4.6 >AC006617-11|AAF39766.2| 356|Caenorhabditis elegans Serpentine receptor, class z protein56 protein. Length = 356 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 298 PGKYLIWKNILVVIFGTFSLV 360 P KY+ W+ ++VVIF SLV Sbjct: 228 PQKYIFWQTMIVVIFQLISLV 248 >AL021474-3|CAD54163.1| 519|Caenorhabditis elegans Hypothetical protein Y32F6A.4 protein. Length = 519 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 137 IMRTXMVTVCVSIAAAVPQISPLMGVIGAFCFSILGLI 250 I+RT ++ V +A +VP PL+ ++G ++ +I Sbjct: 363 IVRTGIMVAVVFVAESVPTFGPLLDLVGGSTLTLTSVI 400 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,911,657 Number of Sequences: 27780 Number of extensions: 208331 Number of successful extensions: 418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -