BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0537 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 93 5e-21 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 93 5e-21 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 93 5e-21 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 93 5e-21 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 26 1.2 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 6.4 Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. 23 8.4 Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. 23 8.4 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 8.4 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 8.4 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 93.5 bits (222), Expect = 5e-21 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +2 Query: 500 GHPLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVE 640 G LISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLS+HQLVE Sbjct: 44 GTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVE 90 Score = 63.3 bits (147), Expect = 6e-12 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 372 HYTEGAELVDSVLDVVRKESESCDCLQGFQ 461 HYTEGAELVD+VLDVVRKE E+CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 93.5 bits (222), Expect = 5e-21 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +2 Query: 500 GHPLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVE 640 G LISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLS+HQLVE Sbjct: 44 GTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVE 90 Score = 63.3 bits (147), Expect = 6e-12 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 372 HYTEGAELVDSVLDVVRKESESCDCLQGFQ 461 HYTEGAELVD+VLDVVRKE E+CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 93.5 bits (222), Expect = 5e-21 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +2 Query: 500 GHPLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVE 640 G LISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLS+HQLVE Sbjct: 44 GTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVE 90 Score = 63.3 bits (147), Expect = 6e-12 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 372 HYTEGAELVDSVLDVVRKESESCDCLQGFQ 461 HYTEGAELVD+VLDVVRKE E+CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 93.5 bits (222), Expect = 5e-21 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +2 Query: 500 GHPLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVE 640 G LISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLS+HQLVE Sbjct: 44 GTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVE 90 Score = 63.3 bits (147), Expect = 6e-12 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 372 HYTEGAELVDSVLDVVRKESESCDCLQGFQ 461 HYTEGAELVD+VLDVVRKE E+CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 25.8 bits (54), Expect = 1.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 61 MREIVHLQAGQCGNQIGAKFWE 126 MRE + + GQ G QIG W+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 6.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 333 FGQSGAGNNWAKGHYTEGAELVDSVLDVV 419 FG G + G YT +E +D VLD + Sbjct: 343 FGLEQCGTDGVPGVYTRMSEYMDWVLDTM 371 >Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 222 LRRQVRAPRHPVDLEPGTMDSV 287 L + V P H +EPGTM +V Sbjct: 151 LVQPVELPEHEEPVEPGTMATV 172 >Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 222 LRRQVRAPRHPVDLEPGTMDSV 287 L + V P H +EPGTM +V Sbjct: 151 LVQPVELPEHEEPVEPGTMATV 172 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 152 SMPCSSEMISQNLAPIWLPHWPACR*TIS 66 SM C + ++ I L W CR TIS Sbjct: 335 SMECFDALRKADIYAIGLIFWEVCRRTIS 363 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 115 KFWEIISDEHGIDPTG 162 KFW + D GI+ TG Sbjct: 225 KFWPTVCDYFGIESTG 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,329 Number of Sequences: 2352 Number of extensions: 17862 Number of successful extensions: 65 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -