BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0525 (870 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.77 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 25 1.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.0 bits (52), Expect = 0.77 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 381 ILKVANILTAFRYFLQPHLKDIGPKIV 461 I++VAN L + L+ K+ GPK+V Sbjct: 614 IIQVANSLRQYEDLLEYEAKEEGPKVV 640 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +2 Query: 548 TVDDNVRVYCSEVTFVSTLKCKAQGHVSSLNWGPL 652 T++D V ++CS ++ L + G+V+ +G L Sbjct: 84 TLNDVVFIFCSAPIIITILDIEILGYVNKAKFGKL 118 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,641 Number of Sequences: 336 Number of extensions: 4521 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23996456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -