BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0525 (870 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 25 1.2 AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 22 6.4 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 22 6.4 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 8.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 8.5 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 24.6 bits (51), Expect = 1.2 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +2 Query: 524 HTTKIAVATVDDNVRVYCSEVTFVSTLK 607 H T + + ++D+N Y +++ F T K Sbjct: 66 HVTVMGLDSIDENSMTYAADIFFAQTWK 93 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 22.2 bits (45), Expect = 6.4 Identities = 8/43 (18%), Positives = 22/43 (51%) Frame = +1 Query: 28 HKFISKMSIFHSFPNLPGPEETAFCKLNEVYCCGNARYGNIST 156 H++ ++ ++ PGP++ + + + +C N + G + T Sbjct: 56 HRYNFQLKPYNPEHKPPGPKDLVYLEPSPPFCEKNPKLGILGT 98 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 22.2 bits (45), Expect = 6.4 Identities = 8/43 (18%), Positives = 22/43 (51%) Frame = +1 Query: 28 HKFISKMSIFHSFPNLPGPEETAFCKLNEVYCCGNARYGNIST 156 H++ ++ ++ PGP++ + + + +C N + G + T Sbjct: 57 HRYNFQLKPYNPEHKPPGPKDLVYLEPSPPFCEKNPKLGILGT 99 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 8.5 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +1 Query: 160 SNATKKHPIINVTRDLHHHRTS 225 S K+HPI+ + + H +T+ Sbjct: 139 SQLIKRHPIVTIMGHVDHGKTT 160 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 8.5 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +2 Query: 674 GCEPGVIVWTVXPKFXGPQNLLPGMLVP 757 GC+PG +V + P P G P Sbjct: 972 GCQPGGVVQSQQPIMTDPSPFKRGRYTP 999 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,988 Number of Sequences: 438 Number of extensions: 5068 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28159464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -