BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0524 (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 4.6 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 4.6 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 22 6.1 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 331 SSGQLSSESTMQTVSLRRLPLSKTVSHGRVEVAP 230 +SG +S +T +S R+P T SH ++ P Sbjct: 19 NSGDSTSSATSIDLSTFRVPTYGTTSHPTSKLVP 52 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 331 SSGQLSSESTMQTVSLRRLPLSKTVSHGRVEVAP 230 +SG +S +T +S R+P T SH ++ P Sbjct: 19 NSGDSTSSATSIDLSTFRVPTYGTTSHPTSKLVP 52 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 163 WVCPCDGGSRSINHQGFYYLPFYS 92 W+C + S + FYYLP S Sbjct: 49 WICALVNYNVSEISENFYYLPAMS 72 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,195 Number of Sequences: 336 Number of extensions: 3451 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -