BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0518 (381 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 22 8.7 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 22 8.7 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 21.8 bits (44), Expect = 8.7 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 100 QDITTDNQLNGNAENGGGDSQDHNSAXXPGRDDD 201 +D DN N +++ GD+ A DDD Sbjct: 756 EDTKADNMNNNHSDQLTGDNSADERAVPNDADDD 789 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 21.8 bits (44), Expect = 8.7 Identities = 10/33 (30%), Positives = 12/33 (36%) Frame = +1 Query: 103 DITTDNQLNGNAENGGGDSQDHNSAXXPGRDDD 201 DI G GGG +D + DDD Sbjct: 1706 DIIVSGSGGGGGGGGGGGEEDGSDKEEDDDDDD 1738 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 353,165 Number of Sequences: 2352 Number of extensions: 5739 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29074284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -