BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0514 (493 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0083 - 1046086-1047086,1047976-1048161,1048266-1049247 28 4.7 06_03_1298 + 29141578-29141623,29142129-29142250,29143818-291438... 27 6.2 >10_01_0083 - 1046086-1047086,1047976-1048161,1048266-1049247 Length = 722 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Frame = +2 Query: 122 VPFVRHFFCAQLSL---SKSPIDNYGCQSDRQL-TSATS 226 VPFV F A +S + P+DNY C+S +ATS Sbjct: 266 VPFVLDFAIANVSCPAQGQPPLDNYACRSSNSFCVNATS 304 >06_03_1298 + 29141578-29141623,29142129-29142250,29143818-29143874, 29143983-29144138,29144220-29144304,29144575-29144665, 29144807-29144971,29145064-29145186,29145334-29145409, 29145513-29145642,29145951-29147824,29148339-29148529, 29148697-29148860,29149164-29149275,29149276-29149294 Length = 1136 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 305 REVHTNSYESVFCKCFVSIF 246 R V SY FCKC+V +F Sbjct: 1110 RSVFFESYAFAFCKCYVGLF 1129 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,292,976 Number of Sequences: 37544 Number of extensions: 155240 Number of successful extensions: 300 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 300 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1023611560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -