Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0514
         (493 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-2884|ABI31322.1| 1839|Drosophila melanogaster CG7527-PB...    29   4.5  

>AE014134-2884|ABI31322.1| 1839|Drosophila melanogaster CG7527-PB,
           isoform B protein.
          Length = 1839

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 1/70 (1%)
 Frame = +3

Query: 129 LFDISFAHNFHCQSHPLTITAVRVTDSSRQQQVEF-ISGSKNGNKTFAKNTFIRIRVYFP 305
           L++     N   QS  LT+ A    D +    + + I+G   GN    +NT   I V  P
Sbjct: 80  LYETEIDENADLQSTVLTVNA---KDHNESTNIRYQITGGNIGNAFAVQNTTGVIYVASP 136

Query: 306 LDYDFSQLFE 335
           LDY+    +E
Sbjct: 137 LDYETRPRYE 146


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,937,114
Number of Sequences: 53049
Number of extensions: 308784
Number of successful extensions: 594
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 583
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 594
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1721789184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)