SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0514
         (493 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     21   5.4  
AY263366-1|AAO92605.1|  139|Apis mellifera octopamine receptor p...    21   9.4  
AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    21   9.4  

>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 21.4 bits (43), Expect = 5.4
 Identities = 12/47 (25%), Positives = 24/47 (51%)
 Frame = +3

Query: 279 FIRIRVYFPLDYDFSQLFEELLSLMWSL*YIQTILVS*LYSCSFENV 419
           F +IRV+   DY  ++ F  L +  +    ++ +L+     C+F +V
Sbjct: 80  FDKIRVFLDEDYSSAEHFTALGNFYFVHESLKNVLLWDFQECTFISV 126


>AY263366-1|AAO92605.1|  139|Apis mellifera octopamine receptor
           protein.
          Length = 139

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 5/10 (50%), Positives = 9/10 (90%)
 Frame = -3

Query: 287 SYESVFCKCF 258
           +++S+ CKCF
Sbjct: 72  AFKSIICKCF 81


>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 5/10 (50%), Positives = 9/10 (90%)
 Frame = -3

Query: 287 SYESVFCKCF 258
           +++S+ CKCF
Sbjct: 520 AFKSIICKCF 529


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,524
Number of Sequences: 438
Number of extensions: 2030
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 13544190
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -