BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0513 (839 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 27 0.94 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 25 2.2 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 26.6 bits (56), Expect = 0.94 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -2 Query: 556 IFVINNNH*ATMYYQLIRRILIIS--LGKSHWNLTHR 452 +F+ NH T YYQL RI +S L +S L H+ Sbjct: 3238 VFLSTVNHSRTFYYQLCERIAALSDELEESRHILQHK 3274 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 25.4 bits (53), Expect = 2.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 343 QENETVIRHKILDEFHKQFSFNSRHIQVKRQCQTLFSVL 227 + NE +++ ILD KQ F + K C+++ S L Sbjct: 438 RSNEQILKSMILDPRIKQLGFQDDVEKFKNICESIISEL 476 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 780,748 Number of Sequences: 2352 Number of extensions: 14517 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88891965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -