Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0513
         (839 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z67738-2|CAA91546.2|  482|Caenorhabditis elegans Hypothetical pr...    28   7.2  

>Z67738-2|CAA91546.2|  482|Caenorhabditis elegans Hypothetical
           protein W03G11.3 protein.
          Length = 482

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = -2

Query: 367 LYHNPL-FSQENETVIRHKILDEFHKQFSFNSRHIQVKRQCQTLFSVLTSPPGFVWFLQV 191
           LY N   F  E  T++   ILD  H+QF   S    VK    T  ++L +      F + 
Sbjct: 382 LYQNVYNFQLEEHTIVYAWILDTSHEQFELKS----VKTTKNTTATILGTDVVLTGFEES 437

Query: 190 SAVVFLVLRERWK 152
            +++ L  +  WK
Sbjct: 438 DSMIILSSKIDWK 450


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,086,899
Number of Sequences: 27780
Number of extensions: 332550
Number of successful extensions: 945
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 875
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 945
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2077023564
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)