Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0513
         (839 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ780964-1|CAG62942.2|  332|Apis mellifera putative corticotropi...    26   0.50 
AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone este...    22   6.1  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    22   6.1  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    22   6.1  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                22   6.1  
AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.           22   6.1  
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    22   8.1  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    22   8.1  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    22   8.1  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    22   8.1  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    22   8.1  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    22   8.1  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    22   8.1  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    22   8.1  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    22   8.1  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    22   8.1  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    22   8.1  

>AJ780964-1|CAG62942.2|  332|Apis mellifera putative corticotropin
           releasing hormone-binding protein protein.
          Length = 332

 Score = 25.8 bits (54), Expect = 0.50
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = -2

Query: 346 SQENETVIRHKILDEFHKQFSFNSRHIQVKRQCQTLFSVLTSP 218
           S +N  VI ++I  +  K FS  +R ++  R C  L + LT P
Sbjct: 164 SSQNIAVIEYRI-PKSGKGFSLFARFLKNPRPCNVLATSLTEP 205


>AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone
           esterase protein.
          Length = 567

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -3

Query: 399 NPNEGTINYLH 367
           NPNE +++YLH
Sbjct: 516 NPNEKSLHYLH 526


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -3

Query: 657 FNKYNNHDYSKY 622
           +N YNN++Y+ Y
Sbjct: 330 YNNYNNNNYNNY 341


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -3

Query: 657 FNKYNNHDYSKY 622
           +N YNN++Y+ Y
Sbjct: 338 YNNYNNNNYNNY 349


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = -1

Query: 284 LQFSSYSGKAAVSDTVFCSYVSSWFCLVSSSLRCCIPCPP 165
           LQ   Y     +S++ + SYV+S +   +     C P PP
Sbjct: 361 LQHLHYRQPPTLSES-YSSYVNSMYASGAQFATPCTPSPP 399


>AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.
          Length = 567

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -3

Query: 399 NPNEGTINYLH 367
           NPNE +++YLH
Sbjct: 516 NPNEKSLHYLH 526


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 331 YNNYNKHNYNK 341


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 657 FNKYNNHDYSK 625
           +N YN H+Y+K
Sbjct: 331 YNNYNKHNYNK 341


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 214,826
Number of Sequences: 438
Number of extensions: 4734
Number of successful extensions: 38
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26945694
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)