BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0507 (800 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 23 2.1 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.8 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 8.7 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 23.4 bits (48), Expect = 2.1 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +1 Query: 289 GMFVRLVHF*FQNETIKRTNAPVRSVX-YVILYVPCAILKFYSLKRIIIFHMVFLFKHYM 465 G+F ++ F + +T V +V +V Y P A + FY L + + KH++ Sbjct: 82 GLFC-ILKFALDGLMLDKTGICVSNVFDFVHFYYPVATMSFYVLNFFGSIQFIIISKHWV 140 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/52 (25%), Positives = 28/52 (53%) Frame = +1 Query: 28 SIHLSYISCPVRSLTYIH*GEEETFVIGRINFLVLEILKFFICSLVLRVACV 183 ++HL + C + Y+H F+I ++ L L + +F C+L++ + C+ Sbjct: 249 TVHLLLLVC-IYYFYYMHLLFCCAFIIFTMHLLFLLCIYYFYCALII-LLCI 298 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.4 bits (43), Expect = 8.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 67 LTYIH*GEEETFVIGRINFLVLEILKFFICSLVLRV 174 + YI E ET G + VLE++ CS RV Sbjct: 249 IPYIQYTETETKTWGSVFNTVLELMPKHACSEYCRV 284 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,429 Number of Sequences: 336 Number of extensions: 3333 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -