BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0499 (783 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 49 5e-08 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 41 1e-05 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.8 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 4.8 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 8.4 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 48.8 bits (111), Expect = 5e-08 Identities = 27/87 (31%), Positives = 42/87 (48%) Frame = +1 Query: 295 LPRGETFVHTNELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERINGGMFVYAFTAACFH 474 L R E F + A K+ R+ A+ D + A + R+R+N +F YAF+ A H Sbjct: 74 LGRHENFSLFIPKHRKVAGKLIRIFLAAESIDDLLSNAVFCRDRVNPYLFYYAFSVALLH 133 Query: 475 RTDCKGLYLXALTRSIPNFFVDXHVIS 555 R D + L L + P+ +VD V + Sbjct: 134 RPDTQNLDLPSFIHVFPDKYVDSQVFA 160 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 40.7 bits (91), Expect = 1e-05 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +1 Query: 379 KDFDVFMRTACWMRERINGGMFVYAFTAACFHRTDCKGLYLXALTRSIPNFFVDXHVIS 555 ++ D + A + R+R+N +F YA + A HR D + + L + S P+ +VD V + Sbjct: 102 RNVDDLLSVAVYARDRVNPYLFSYALSVAILHRQDTQDIDLPSFIESFPDKYVDSKVFA 160 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 447 DEHASVDPFSHPARSPHENIEVLSVVEDSEDFDGFF 340 D ++ P + P R P +N + L +E S + G F Sbjct: 125 DMETTLTPCASPNRKPDDNQDHLRRLEMSLEKSGLF 160 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 671 EXRRLLYXKTVVXVLFHGGTST 736 + ++ Y TV + +GGTST Sbjct: 254 QGKKFAYNSTVKVAVIYGGTST 275 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 123 DMKMKELCIMKLLDHI 170 D K+ LC+ L+DH+ Sbjct: 442 DEKLNALCMTWLMDHV 457 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,599 Number of Sequences: 336 Number of extensions: 2486 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -