BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0499 (783 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.05c |rec27|mug41|meiotic recombination protein Rec27|Sch... 26 7.0 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 25 9.3 >SPBC577.05c |rec27|mug41|meiotic recombination protein Rec27|Schizosaccharomyces pombe|chr 2|||Manual Length = 134 Score = 25.8 bits (54), Expect = 7.0 Identities = 10/40 (25%), Positives = 24/40 (60%) Frame = +3 Query: 114 VNLDMKMKELCIMKLLDHILQPXMFEDIKEIAKEYNIXKS 233 VNL K ++ ++++H+L+ ++I+ K+Y+ +S Sbjct: 12 VNLKKKQLQITSSEIIEHVLEELNLKNIERRVKKYDQIES 51 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 25.4 bits (53), Expect = 9.3 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -1 Query: 528 VRDRSRKSGQVETLAVGSVEARGSKSVDEHASVDPFSHPARSP 400 V DRS + + S E + SV++H V + P RSP Sbjct: 1750 VSDRSFSIVESTVPTIASGEGDDNHSVEDHLKVPTDNEPRRSP 1792 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,572,717 Number of Sequences: 5004 Number of extensions: 41693 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -