BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0499 (783 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 31 0.78 10_08_0786 - 20540061-20542106 29 5.5 >10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 Length = 746 Score = 31.5 bits (68), Expect = 0.78 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +2 Query: 23 GSSTTGLLGRGVTSSD*WWLRDDGLHQGTNG 115 GS T G +G G T SD WW +D+G G+NG Sbjct: 369 GSRTGGTMGSG-TGSDWWWKQDNG--GGSNG 396 >10_08_0786 - 20540061-20542106 Length = 681 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 253 RVVKQFMEMYKMGMLPRGETFVHTNELQMEEAVKVFRVLYYAK 381 +V K +EM KMG +PR E H +EE VK ++ Y+++ Sbjct: 577 KVAKLDLEMRKMGYIPRTEFVYH----DLEEEVKEQQLSYHSE 615 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,281,032 Number of Sequences: 37544 Number of extensions: 312019 Number of successful extensions: 795 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -