BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0497 (453 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 27 0.095 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 3.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 3.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 6.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 6.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 6.3 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 27.1 bits (57), Expect = 0.095 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 98 VCSRRTRTHKR*EPFKLFCVFSWRXYMPTEPQSP 199 VCS R EP +F + YMP+EP++P Sbjct: 934 VCSNYLREISDGEPLYVFVRSAPNFYMPSEPKAP 967 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 436 ISLAALASQKXEIGRXPPCQXHS 368 + AAL SQ ++ PP HS Sbjct: 1118 VRCAALTSQSLQVSWQPPPNTHS 1140 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 436 ISLAALASQKXEIGRXPPCQXHS 368 + AAL SQ ++ PP HS Sbjct: 1114 VRCAALTSQSLQVSWQPPPNTHS 1136 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 199 DSKLXRPHLXQQSSSVDRIRTMTXEKS 279 DSKL + + +S+ DRIR +T K+ Sbjct: 541 DSKLCQQCVGNLASNNDRIRQVTKCKA 567 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 199 DSKLXRPHLXQQSSSVDRIRTMTXEKS 279 DSKL + + +S+ DRIR +T K+ Sbjct: 541 DSKLCQQCVGNLASNNDRIRQVTKCKA 567 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 199 DSKLXRPHLXQQSSSVDRIRTMTXEKS 279 DSKL + + +S+ DRIR +T K+ Sbjct: 541 DSKLCQQCVGNLASNNDRIRQVTKCKA 567 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.127 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,432 Number of Sequences: 438 Number of extensions: 1750 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.3 bits)
- SilkBase 1999-2023 -