BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0497 (453 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01400.1 68414.m00055 hypothetical protein 28 3.4 At5g52230.1 68418.m06483 expressed protein 27 7.8 At3g48350.1 68416.m05277 cysteine proteinase, putative similar t... 27 7.8 >At1g01400.1 68414.m00055 hypothetical protein Length = 204 Score = 27.9 bits (59), Expect = 3.4 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 122 HKR*EPFKLFC---VFSWRXYMPTEPQSPTPNSXDRIFXNSHPRLTAY 256 HKR F C VF W Y P EP P+ + + NSH AY Sbjct: 117 HKRLPVFDEVCSGAVFPW--YGPQEPDLPSSSGIGTMSANSHDDRRAY 162 >At5g52230.1 68418.m06483 expressed protein Length = 746 Score = 26.6 bits (56), Expect = 7.8 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 271 EKSQTSILTRTKTGDEVXSSNVRKXTSAXENNKN 372 ++S +L + KT D+V S R +S+ E++KN Sbjct: 118 KRSADDVLEKEKTIDDVRRSKRRNLSSSDEHSKN 151 >At3g48350.1 68416.m05277 cysteine proteinase, putative similar to cysteine endopeptidase precursor [Ricinus communis] GI:2944446; contains Pfam profile PF00112: Papain family cysteine protease Length = 364 Score = 26.6 bits (56), Expect = 7.8 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = -3 Query: 208 VWSRRLRFRWHIXTPRKDTE*LERFSSFVRXGSARTHRNPSKLMKYKV 65 VW R+R H R E ++RF+ F R HR K YK+ Sbjct: 34 VWKLYERWRGHHSVSRASHEAIKRFNVF-RHNVLHVHRTNKKNKPYKL 80 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.127 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,956,322 Number of Sequences: 28952 Number of extensions: 127935 Number of successful extensions: 221 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 742437000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -