BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0493 (569 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 26 0.75 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 25 2.3 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 5.3 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 23 7.0 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 26.2 bits (55), Expect = 0.75 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 311 DVWQQFLEGWIVVQVVFDGLRIIVFFPMST 222 D++ Q E W V +V D L++ +FF ++T Sbjct: 461 DLYIQTREDWKYVAMVIDRLQLYIFFIVTT 490 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 24.6 bits (51), Expect = 2.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 252 QAIKDHLDNNPALEKLLPHIKGNVGFV 332 QA+ HL NNP ++ L +K V V Sbjct: 109 QAVLSHLRNNPITDEHLAKVKRGVEIV 135 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 5.3 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -2 Query: 508 KILVGIERAXKKEVFSGPRPVLXAGMTTD--NGAMAPGRAGAWTLFSN 371 K + GI+ A K ++ R + +TTD N ++ GR G ++FS+ Sbjct: 2303 KEIKGIDEAKSKNIWDALRE--KSFLTTDCTNPSLCHGREGTKSIFSD 2348 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.0 bits (47), Expect = 7.0 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 372 TVCHGPQRGLRG*TRSQRCP*CVATVSRGLDC 277 T+C G G+ ++Q C C A V GL+C Sbjct: 12 TLC-GEVTGVSYRGQAQTCRNCAAPVHHGLNC 42 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,358 Number of Sequences: 2352 Number of extensions: 11346 Number of successful extensions: 91 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -