Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0492
         (677 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0729 + 22611836-22612028,22612297-22612376                       28   6.0  

>12_02_0729 + 22611836-22612028,22612297-22612376
          Length = 90

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 15/38 (39%), Positives = 19/38 (50%)
 Frame = -3

Query: 609 EWKLVEFIGAGSDDAVIDLLGGAARARYGQTVIGQSAG 496
           EW +    G G DDAV +   G AR R G+  +  S G
Sbjct: 26  EWSVKTKEGGGGDDAVEEEDEGKARWRKGRRALDPSGG 63


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,632,537
Number of Sequences: 37544
Number of extensions: 354383
Number of successful extensions: 950
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 933
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 950
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1726796312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)