BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0491 (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 25 2.3 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 9.5 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 9.5 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 23 9.5 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 23 9.5 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 581 WDSLVSANPRVSAVVKAELRQHFCSLLAKDXTLPMGAXALP 703 WD + A R+ +V++ + R+ +L A + P A +LP Sbjct: 999 WDRIQQAARRILSVLQEDWREEQQTLAAAEAAQPDPASSLP 1039 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 422 CLQWRKETVCKFSPSNQVYE 363 CLQ +K+ CK S Q Y+ Sbjct: 243 CLQNQKKLACKKSTCQQAYD 262 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 422 CLQWRKETVCKFSPSNQVYE 363 CLQ +K+ CK S Q Y+ Sbjct: 243 CLQNQKKLACKKSTCQQAYD 262 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = +3 Query: 225 ELYKEVVDDRLALGVERTKSELIPFLTETIYDEDEVLLALAEQLG 359 ++ +EV+ +R ++ V +E++ + + DE+ + AL LG Sbjct: 363 DIIQEVIGERGSVTVRTEMAEVVLTGIDNMIDEEAIKKALMTTLG 407 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 593 VSANPRVSAVVKAELRQHFCSLLAKDXTLPMG 688 ++A + +KA RQHF L + P G Sbjct: 315 IAARSELQRAIKASKRQHFLKLCDEIARKPWG 346 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,216 Number of Sequences: 2352 Number of extensions: 13463 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -