SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0485
         (772 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles ...    26   1.5  
AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            25   2.0  
AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            25   2.0  
EF519478-2|ABP73566.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519476-2|ABP73562.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519474-2|ABP73558.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519473-2|ABP73556.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519471-2|ABP73552.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519470-2|ABP73550.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519469-2|ABP73548.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519468-2|ABP73546.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519467-2|ABP73544.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519466-2|ABP73542.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519465-2|ABP73540.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519464-2|ABP73538.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519463-2|ABP73536.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519462-2|ABP73534.1|  163|Anopheles gambiae CTL4 protein.            23   7.9  
EF519461-2|ABP73532.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519460-2|ABP73530.1|  166|Anopheles gambiae CTL4 protein.            23   7.9  
EF519459-2|ABP73528.1|  166|Anopheles gambiae CTL4 protein.            23   7.9  
EF519458-2|ABP73526.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519457-2|ABP73524.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519456-2|ABP73522.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519455-2|ABP73520.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519454-2|ABP73518.1|  161|Anopheles gambiae CTL4 protein.            23   7.9  
EF519453-2|ABP73516.1|  176|Anopheles gambiae CTL4 protein.            23   7.9  
EF519452-2|ABP73514.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519451-2|ABP73512.1|  171|Anopheles gambiae CTL4 protein.            23   7.9  
EF519450-2|ABP73510.1|  171|Anopheles gambiae CTL4 protein.            23   7.9  
EF519449-2|ABP73508.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519447-2|ABP73504.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519446-2|ABP73502.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519444-2|ABP73498.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519443-2|ABP73496.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519442-2|ABP73494.1|  177|Anopheles gambiae CTL4 protein.            23   7.9  
EF519441-2|ABP73492.1|  164|Anopheles gambiae CTL4 protein.            23   7.9  
EF519440-2|ABP73490.1|  165|Anopheles gambiae CTL4 protein.            23   7.9  
EF519439-2|ABP73488.1|  152|Anopheles gambiae CTL4 protein.            23   7.9  
EF519438-2|ABP73486.1|  161|Anopheles gambiae CTL4 protein.            23   7.9  
EF519437-2|ABP73484.1|  165|Anopheles gambiae CTL4 protein.            23   7.9  
AF017062-1|AAC47144.2|  649|Anopheles gambiae soluble guanylyl c...    23   7.9  

>M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 442

 Score = 25.8 bits (54), Expect = 1.5
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = +3

Query: 456 ARFHPRCQTAHRRSKQNGSTEPPYS 530
           ARF P   T+HR S  N S+  P S
Sbjct: 344 ARFDPSALTSHRSSSANCSSAAPKS 368


>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 25.4 bits (53), Expect = 2.0
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = +3

Query: 654  EPFNQNALGXQGMGRWSVKEGQKLDGKXALH 746
            EP+ QN +G  G  +W+    Q   G   LH
Sbjct: 1335 EPYEQNQIGSDGRWKWNGGTIQIEQGNHFLH 1365


>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 25.4 bits (53), Expect = 2.0
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = +3

Query: 654  EPFNQNALGXQGMGRWSVKEGQKLDGKXALH 746
            EP+ QN +G  G  +W+    Q   G   LH
Sbjct: 1336 EPYEQNQIGSDGRWKWNGGTIQIEQGNHFLH 1366


>EF519478-2|ABP73566.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519476-2|ABP73562.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519474-2|ABP73558.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519473-2|ABP73556.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519471-2|ABP73552.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519470-2|ABP73550.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519469-2|ABP73548.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519468-2|ABP73546.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519467-2|ABP73544.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519466-2|ABP73542.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519465-2|ABP73540.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519464-2|ABP73538.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519463-2|ABP73536.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519462-2|ABP73534.1|  163|Anopheles gambiae CTL4 protein.
          Length = 163

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 125 GVAPANNRVEPF 136


>EF519461-2|ABP73532.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519460-2|ABP73530.1|  166|Anopheles gambiae CTL4 protein.
          Length = 166

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 128 GVAPANNRVEPF 139


>EF519459-2|ABP73528.1|  166|Anopheles gambiae CTL4 protein.
          Length = 166

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 128 GVAPANNRVEPF 139


>EF519458-2|ABP73526.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519457-2|ABP73524.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519456-2|ABP73522.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519455-2|ABP73520.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519454-2|ABP73518.1|  161|Anopheles gambiae CTL4 protein.
          Length = 161

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 123 GVAPANNRVEPF 134


>EF519453-2|ABP73516.1|  176|Anopheles gambiae CTL4 protein.
          Length = 176

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 138 GVAPANNRVEPF 149


>EF519452-2|ABP73514.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519451-2|ABP73512.1|  171|Anopheles gambiae CTL4 protein.
          Length = 171

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 133 GVAPANNRVEPF 144


>EF519450-2|ABP73510.1|  171|Anopheles gambiae CTL4 protein.
          Length = 171

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 133 GVAPANNRVEPF 144


>EF519449-2|ABP73508.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519447-2|ABP73504.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519446-2|ABP73502.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519444-2|ABP73498.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519443-2|ABP73496.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519442-2|ABP73494.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 139 GVAPANNRVEPF 150


>EF519441-2|ABP73492.1|  164|Anopheles gambiae CTL4 protein.
          Length = 164

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 126 GVAPANNRVEPF 137


>EF519440-2|ABP73490.1|  165|Anopheles gambiae CTL4 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 127 GVAPANNRVEPF 138


>EF519439-2|ABP73488.1|  152|Anopheles gambiae CTL4 protein.
          Length = 152

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 114 GVAPANNRVEPF 125


>EF519438-2|ABP73486.1|  161|Anopheles gambiae CTL4 protein.
          Length = 161

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 123 GVAPANNRVEPF 134


>EF519437-2|ABP73484.1|  165|Anopheles gambiae CTL4 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 627 GMAPGNNMLEPF 662
           G+AP NN +EPF
Sbjct: 127 GVAPANNRVEPF 138


>AF017062-1|AAC47144.2|  649|Anopheles gambiae soluble guanylyl
           cyclase beta subunit protein.
          Length = 649

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 9/30 (30%), Positives = 18/30 (60%)
 Frame = +1

Query: 472 GVKQLIVGVNKMVPLNHHTVSPDLRKSRRK 561
           G++ +++G+ K V    H V  +++  RRK
Sbjct: 138 GLEHIVIGIVKAVASKLHGVDVEIKIIRRK 167


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 842,700
Number of Sequences: 2352
Number of extensions: 17974
Number of successful extensions: 71
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 69
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 71
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 80249979
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -