BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0485 (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 26 1.5 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.0 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.0 EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. 23 7.9 EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. 23 7.9 EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. 23 7.9 EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. 23 7.9 EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. 23 7.9 EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. 23 7.9 EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. 23 7.9 EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. 23 7.9 EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. 23 7.9 EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. 23 7.9 EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. 23 7.9 EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. 23 7.9 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 23 7.9 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 456 ARFHPRCQTAHRRSKQNGSTEPPYS 530 ARF P T+HR S N S+ P S Sbjct: 344 ARFDPSALTSHRSSSANCSSAAPKS 368 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.4 bits (53), Expect = 2.0 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 654 EPFNQNALGXQGMGRWSVKEGQKLDGKXALH 746 EP+ QN +G G +W+ Q G LH Sbjct: 1335 EPYEQNQIGSDGRWKWNGGTIQIEQGNHFLH 1365 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.4 bits (53), Expect = 2.0 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 654 EPFNQNALGXQGMGRWSVKEGQKLDGKXALH 746 EP+ QN +G G +W+ Q G LH Sbjct: 1336 EPYEQNQIGSDGRWKWNGGTIQIEQGNHFLH 1366 >EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. Length = 163 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 125 GVAPANNRVEPF 136 >EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 128 GVAPANNRVEPF 139 >EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 128 GVAPANNRVEPF 139 >EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 123 GVAPANNRVEPF 134 >EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. Length = 176 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 138 GVAPANNRVEPF 149 >EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 133 GVAPANNRVEPF 144 >EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 133 GVAPANNRVEPF 144 >EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 139 GVAPANNRVEPF 150 >EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. Length = 164 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 126 GVAPANNRVEPF 137 >EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 127 GVAPANNRVEPF 138 >EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. Length = 152 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 114 GVAPANNRVEPF 125 >EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 123 GVAPANNRVEPF 134 >EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 627 GMAPGNNMLEPF 662 G+AP NN +EPF Sbjct: 127 GVAPANNRVEPF 138 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +1 Query: 472 GVKQLIVGVNKMVPLNHHTVSPDLRKSRRK 561 G++ +++G+ K V H V +++ RRK Sbjct: 138 GLEHIVIGIVKAVASKLHGVDVEIKIIRRK 167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 842,700 Number of Sequences: 2352 Number of extensions: 17974 Number of successful extensions: 71 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -