BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0475 (661 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 29 0.78 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 9.7 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 28.7 bits (61), Expect = 0.78 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 5/41 (12%) Frame = -1 Query: 361 SPYAY*TSGSSQLXPFXSTRGF-----CPR*AGLRTLRYSL 254 SPYA+ T S+ L PF STR + P+ LR LR+ L Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSYMGAIPTPQLLDLRALRHGL 1251 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 25.0 bits (52), Expect = 9.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 425 NXXGTSX*KLFILKDR*AVLSQSL 354 N G S KLFI+KD V+SQ L Sbjct: 3491 NIGGRSPQKLFIVKDSGQVMSQDL 3514 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,267,797 Number of Sequences: 5004 Number of extensions: 39277 Number of successful extensions: 68 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -