BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0473 (651 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pomb... 26 5.4 SPCC417.10 |||membrane transporter|Schizosaccharomyces pombe|chr... 25 7.2 SPAC4F8.13c |rng2||IQGAP|Schizosaccharomyces pombe|chr 1|||Manual 25 9.5 >SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1389 Score = 25.8 bits (54), Expect = 5.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 527 PLREIYFS*IRVVRIRDKCYFHCTLNVR 444 PL+ +Y + + D+CYF +N R Sbjct: 153 PLQTVYMQMVDIQESMDRCYFESEVNKR 180 >SPCC417.10 |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 508 Score = 25.4 bits (53), Expect = 7.2 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -3 Query: 145 CLFIV*WGLMIVIFKEKNFK*SIIGRYFSGFFKSLSMSKFAL 20 C+F+V WG ++ + N+ I R G +S + F L Sbjct: 134 CVFLVIWGFLLCMTSVANYPGFIALRVLLGMMESAASPGFIL 175 >SPAC4F8.13c |rng2||IQGAP|Schizosaccharomyces pombe|chr 1|||Manual Length = 1489 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -1 Query: 108 FLKRKTLNNQSLDATSRAFSKVCQC 34 +LK TL+ +SL+ +SR F ++ QC Sbjct: 796 YLKINTLSMKSLNNSSRKFLELYQC 820 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,351,200 Number of Sequences: 5004 Number of extensions: 43860 Number of successful extensions: 85 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -